• Gene id: 10572

Gene Summary

• Gene Symbol: SIVA1   Gene   UCSC   Ensembl
• Aliases: CD27BP, SIVA, Siva-1, Siva-2
• Gene name: SIVA1 apoptosis inducing factor
• Alternate names: apoptosis regulatory protein Siva, CD27-binding (Siva) protein,
• Gene location: 14q32.33 (104752419: 104759658)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) super
• OMIM: 602878

Protein Summary

• Protein general information: O15304  
  • Name: Apoptosis regulatory protein Siva (CD27 binding protein) (CD27BP)
  • Length: 175  
  • Mass: 18695
  • Tissue specificity: Ubiquitous. Mostly expressed in thymus, testis, ovary, prostate, small intestine and spleen and less in colon.
• Sequence:

  MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGP
  TGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVAC
  TLCGLVDCSDMYEKVLCTSCAMFET

• Structural information:
  • Interpro: IPR022773  
  • STRING: ENSP00000329213
• Other Databases: GeneCards:  SIVA1  Malacards:  SIVA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001618	virus receptor activity	ISS	molecular function
GO:0005175	CD27 receptor binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005175	CD27 receptor binding	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq