• Gene id: 10569

Gene Summary

• Gene Symbol: SLU7   Gene   UCSC   Ensembl
• Aliases: 9G8, hSlu7
• Gene name: SLU7 homolog, splicing factor
• Alternate names: pre-mRNA-splicing factor SLU7, SLU7 splicing factor homolog, splicing factor, step II splicing factor SLU7, zinc knuckle motif containing,
• Gene location: 5q33.3 (113410643: 113429689)     Exons: 16     NC_000009.12
• Gene summary(Entrez): Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process. It associates with the splic
• OMIM: 605974

Protein Summary

• Protein general information: O95391  
  • Name: Pre mRNA splicing factor SLU7 (hSlu7)
  • Length: 586  
  • Mass: 68387
• Sequence:

  MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYID
  PSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIA
  PDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEP
  NSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANA
  GKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKLELLYKSFKVKKEDFKEQQKESILEK
  YGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFF
  KYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQEKLKEEKKKKKKKKKKHRKSSSDSDDEEKKHEKL
  KKALNAEEARLLHVKETMQIDERKRPYNSMYETREPTEEEMEAYRMKRQRPDDPMASFLGQ

• Structural information:
  • Interpro: IPR021715  IPR039974  
  • PDB: 5XJC 6ICZ 6QDV
  • PDBsum: 5XJC 6ICZ 6QDV
  • STRING: ENSP00000297151
• Other Databases: GeneCards:  SLU7  Malacards:  SLU7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IDA	molecular function
GO:0000386	second spliceosomal transesterification activity	IDA	molecular function
GO:0030628	pre-mRNA 3'-splice site binding	IDA	molecular function
GO:0030532	small nuclear ribonucleoprotein complex	IDA	cellular component
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0000389	mRNA 3'-splice site recognition	IDA	biological process
GO:0000375	RNA splicing, via transesterification reactions	IDA	biological process
GO:0000380	alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0005681	spliceosomal complex	IBA	cellular component
GO:0008380	RNA splicing	IBA	biological process
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0034605	cellular response to heat	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0006886	intracellular protein transport	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000386	second spliceosomal transesterification activity	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0030628	pre-mRNA 3'-splice site binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq