• Gene id: 10562

Gene Summary

• Gene Symbol: OLFM4   Gene   UCSC   Ensembl
• Aliases: GC1, GW112, OLM4, OlfD, UNQ362, bA209J19.1, hGC-1, hOLfD
• Gene name: olfactomedin 4
• Alternate names: olfactomedin-4, G-CSF-stimulated clone 1 protein, antiapoptotic protein GW112,
• Gene location: 13q14.3 (53028812: 53052056)     Exons: 5     NC_000013.11
• Gene summary(Entrez): This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth
• OMIM: 605836

Protein Summary

• Protein general information: Q6UX06  
  • Name: Olfactomedin 4 (OLM4) (Antiapoptotic protein GW112) (G CSF stimulated clone 1 protein) (hGC 1) (hOLfD)
  • Length: 510  
  • Mass: 57280
  • Tissue specificity: Expressed during myeloid lineage development. Much higher expression in bone marrow neutrophils than in peripheral blood neutrophils (at protein level). Strongly expressed in the prostate, small intestine and colon and moderately expre
• Sequence:

  MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLFSNFTG
  SVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTIS
  YTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKE
  CEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLL
  EYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSY
  ANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRT
  EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLNYDLSVLQKPQ

• Structural information:
  • Protein Domains: (245..50-)
    (/note="Olfactomedin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00446"-)
  • Interpro: IPR003112  IPR031221  IPR011041  
  • Prosite: PS51132
  • DIP: 59533
  • STRING: ENSP00000219022
• Other Databases: GeneCards:  OLFM4  Malacards:  OLFM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042582	azurophil granule	IDA	NOT|cellular component
GO:0042581	specific granule	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005198	structural molecule activity	IDA	molecular function
GO:0030141	secretory granule	IDA	NOT|cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0042981	regulation of apoptotic process	IMP	NOT|biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	IMP	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050764	regulation of phagocytosis	IMP	NOT|biological process
GO:0010939	regulation of necrotic cell death	IMP	NOT|biological process
GO:0005615	extracellular space	HDA	cellular component
GO:2000389	regulation of neutrophil extravasation	IMP	NOT|biological process
GO:0045296	cadherin binding	IMP	molecular function
GO:0032991	protein-containing complex	IMP	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881