• Gene id: 10559

Gene Summary

• Gene Symbol: SLC35A1   Gene   UCSC   Ensembl
• Aliases: CDG2F, CMPST, CST, hCST
• Gene name: solute carrier family 35 member A1
• Alternate names: CMP-sialic acid transporter, CMP-SA-Tr, CMP-Sia-Tr, mutated CMP-sialic acid transporter A1, solute carrier family 35 (CMP-sialic acid transporter), member 1, solute carrier family 35 (CMP-sialic acid transporter), member A1, solute carrier family 35 (UDP-galact,
• Gene location: 6q15 (87472924: 87512338)     Exons: 8     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently
• OMIM: 605634

Protein Summary

• Protein general information: P78382  
  • Name: CMP sialic acid transporter (CMP SA Tr) (CMP Sia Tr) (Solute carrier family 35 member A1)
  • Length: 337  
  • Mass: 36779
• Sequence:

  MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKA
  SLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFM
  LCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGV
  YLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFA
  LGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV

• Structural information:
  • Interpro: IPR007271  
  • STRING: ENSP00000358565
• Other Databases: GeneCards:  SLC35A1  Malacards:  SLC35A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005459	UDP-galactose transmembrane transporter activity	IBA	molecular function
GO:0015297	antiporter activity	ISS	molecular function
GO:0015782	CMP-N-acetylneuraminate transmembrane transport	ISS	biological process
GO:0016021	integral component of membrane	ISS	cellular component
GO:0005456	CMP-N-acetylneuraminate transmembrane transporter activity	ISS	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015165	pyrimidine nucleotide-sugar transmembrane transporter activity	IEA	molecular function
GO:0090481	pyrimidine nucleotide-sugar transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005456	CMP-N-acetylneuraminate transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0015782	CMP-N-acetylneuraminate transmembrane transport	TAS	biological process
GO:0005456	CMP-N-acetylneuraminate transmembrane transporter activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005456	CMP-N-acetylneuraminate transmembrane transporter activity	IEA	molecular function
GO:0015782	CMP-N-acetylneuraminate transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0072334	UDP-galactose transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Congenital disorders of glycosylation type II	KEGG:H00119
Congenital disorders of glycosylation type II	KEGG:H00119
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881