• Gene id: 10555

Gene Summary

• Gene Symbol: AGPAT2   Gene   UCSC   Ensembl
• Aliases: 1-AGPAT2, BSCL, BSCL1, LPAAB, LPAAT-beta
• Gene name: 1-acylglycerol-3-phosphate O-acyltransferase 2
• Alternate names: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta, 1-AGP acyltransferase 2, 1-AGPAT 2, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), lysophosphatidic acid acyltransferase-beta, testicular tissue protein Li 143,
• Gene location: 9q34.3 (136849408: 136851023)     Exons: 3     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosyn
• OMIM: 603100

Protein Summary

• Protein general information: O15120  
  • Name: 1 acyl sn glycerol 3 phosphate acyltransferase beta (EC 2.3.1.51) (1 acylglycerol 3 phosphate O acyltransferase 2) (1 AGP acyltransferase 2) (1 AGPAT 2) (Lysophosphatidic acid acyltransferase beta) (LPAAT beta)
  • Length: 278  
  • Mass: 30914
  • Tissue specificity: Expressed predominantly in adipose tissue, pancreas and liver. {ECO
• Sequence:

  MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYG
  LRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAM
  TVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTV
  QVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ

• Structural information:
  • Interpro: IPR004552  IPR002123  
  • STRING: ENSP00000360761
• Other Databases: GeneCards:  AGPAT2  Malacards:  AGPAT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006654	phosphatidic acid biosynthetic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IMP	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0008544	epidermis development	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IC	biological process
GO:0001819	positive regulation of cytokine production	IMP	biological process
GO:0006654	phosphatidic acid biosynthetic process	IGI	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	NAS	molecular function
GO:0006644	phospholipid metabolic process	NAS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Congenital generalized lipodystrophy	KEGG:H00419
Congenital generalized lipodystrophy	KEGG:H00419
Lipodystrophy	PMID:11967537
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray