• Gene id: 10554

Gene Summary

• Gene Symbol: AGPAT1   Gene   UCSC   Ensembl
• Aliases: 1-AGPAT1, G15, LPAAT-alpha, LPAATA
• Gene name: 1-acylglycerol-3-phosphate O-acyltransferase 1
• Alternate names: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, 1-AGP acyltransferase 1, 1-AGPAT 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, ,
• Gene location: 6p21.32 (88226992: 88205114)     Exons: 9     NC_000007.14
• Gene summary(Entrez): This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. Thi
• OMIM: 603099

Protein Summary

• Protein general information: Q99943  
  • Name: 1 acyl sn glycerol 3 phosphate acyltransferase alpha (EC 2.3.1.51) (1 acylglycerol 3 phosphate O acyltransferase 1) (1 AGP acyltransferase 1) (1 AGPAT 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT alpha) (Protein G15)
  • Length: 283  
  • Mass: 31717
  • Tissue specificity: Widely expressed. Expressed in adipose tissue and at high levels in testis and pancreas. Expressed at lower levels in tissues such as heart, brain, placenta, kidney, lung, spleen, thymus, prostate, ovary, intestine, colon, leukocyte an
• Sequence:

  MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLH
  IKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRK
  RTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFT
  SGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG

• Structural information:
  • Interpro: IPR004552  IPR002123  
  • STRING: ENSP00000378877
• Other Databases: GeneCards:  AGPAT1  Malacards:  AGPAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006654	phosphatidic acid biosynthetic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0031325	positive regulation of cellular metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IGI	molecular function
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IC	biological process
GO:0001819	positive regulation of cytokine production	IMP	biological process
GO:0006654	phosphatidic acid biosynthetic process	IGI	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)