• Gene id: 10553

Gene Summary

• Gene Symbol: HTATIP2   Gene   UCSC   Ensembl
• Aliases: CC3, SDR44U1, TIP30
• Gene name: HIV-1 Tat interactive protein 2
• Alternate names: oxidoreductase HTATIP2, 30 kDa HIV-1 TAT-interacting protein, HIV-1 TAT-interactive protein 2, HIV-1 Tat interactive protein 2, 30kDa, Tat-interacting protein (30kD), short chain dehydrogenase/reductase family 44U, member 1,
• Gene location: 11p15.1 (20363684: 20383782)     Exons: 6     NC_000011.10
• OMIM: 605628

Protein Summary

• Protein general information: Q9BUP3  
  • Name: Oxidoreductase HTATIP2 (EC 1.1.1. ) (30 kDa HIV 1 TAT interacting protein) (HIV 1 TAT interactive protein 2)
  • Length: 242  
  • Mass: 27049
  • Tissue specificity: Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepato
• Sequence:

  MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKL
  DDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEV
  EAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELL
  ENKAIHDLGKAHGSLKP

• Structural information:
  • Interpro: IPR016040  IPR036291  
  • PDB: 2BKA
  • PDBsum: 2BKA
  • STRING: ENSP00000392985
• Other Databases: GeneCards:  HTATIP2  Malacards:  HTATIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051170	import into nucleus	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0043068	positive regulation of programmed cell death	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051170	import into nucleus	IDA	biological process
GO:0045765	regulation of angiogenesis	IDA	biological process
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)