• Gene id: 10552

Gene Summary

• Gene Symbol: ARPC1A   Gene   UCSC   Ensembl
• Aliases: Arc40, HEL-68, HEL-S-307, SOP2Hs, SOP2L
• Gene name: actin related protein 2/3 complex subunit 1A
• Alternate names: actin-related protein 2/3 complex subunit 1A, SOP2-like protein, actin binding protein (Schizosaccharomyces pombe sop2-like), actin related protein 2/3 complex, subunit 1A, 41kDa, epididymis luminal protein 68, epididymis secretory protein Li 307, epididymis se,
• Gene location: 7q22.1 (99325872: 99366261)     Exons: 10     NC_000007.14
• Gene summary(Entrez): This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1B. The similarity between these two proteins suggests that they bo
• OMIM: 604220

Protein Summary

• Protein general information: Q92747  
  • Name: Actin related protein 2/3 complex subunit 1A (SOP2 like protein)
  • Length: 370  
  • Mass: 41569
• Sequence:

  MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRN
  AYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDW
  HPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHD
  STVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
  ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLRIM

• Structural information:
  • Interpro: IPR030140  IPR017383  IPR015943  IPR001680  IPR017986   IPR036322  
  • Prosite: PS50082 PS50294
  • DIP: 33142
  • STRING: ENSP00000262942
• Other Databases: GeneCards:  ARPC1A  Malacards:  ARPC1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0005885	Arp2/3 protein complex	IBA	cellular component
GO:0005885	Arp2/3 protein complex	ISS	cellular component
GO:0035861	site of double-strand break	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003779	actin binding	TAS	molecular function
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0036195	muscle cell projection membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04666	Fc gamma R-mediated phagocytosis
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
pancreatic cancer	PMID:19145645
Schizophrenia	PMID:15098003
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)