Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 10551
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol AGR2   Gene   UCSC   Ensembl
Aliases AG-2, AG2, GOB-4, HAG-2, HEL-S-116, HPC8, PDIA17, XAG-2
Gene name anterior gradient 2, protein disulphide isomerase family member
Alternate names anterior gradient protein 2 homolog, anterior gradient homolog 2, epididymis secretory protein Li 116, protein disulfide isomerase family A, member 17, secreted cement gland homolog, secreted cement gland protein XAG-2 homolog,
Gene location 7p21.1 (16804998: 16791810)     Exons: 8     NC_000007.14
Gene summary(Entrez) This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically ac
OMIM 606358

Protein Summary
Protein general information O95994  

Name: Anterior gradient protein 2 homolog (AG 2) (hAG 2) (HPC8) (Secreted cement gland protein XAG 2 homolog)

Length: 175  Mass: 19979

Tissue specificity: Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis

Sequence MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMII
HHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY
AYEPADTALLLDNMKKALKLLKTEL
Structural information
Interpro:  IPR036249  

PDB:  		 2LNS 2LNT
PDBsum:   2LNS 2LNT

DIP:  
48825
STRING:   ENSP00000391490
Other Databases GeneCards:  AGR2  Malacards:  AGR2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005783 endoplasmic reticulum
 IBA cellular component
GO:0060548 negative regulation of ce
ll death
 IBA biological process
GO:0002162 dystroglycan binding
 IBA molecular function
GO:0002162 dystroglycan binding
 IDA molecular function
GO:0070254 mucus secretion
 ISS biological process
GO:0005783 endoplasmic reticulum
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005576 extracellular region
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048546 digestive tract morphogen
esis
 IEA biological process
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0048639 positive regulation of de
velopmental growth
 IEA biological process
GO:0060480 lung goblet cell differen
tiation
 IEA biological process
GO:0070254 mucus secretion
 IEA biological process
GO:0005576 extracellular region
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:1903896 positive regulation of IR
E1-mediated unfolded prot
ein response
 IDA biological process
GO:0005615 extracellular space
 IDA cellular component
GO:1903899 positive regulation of PE
RK-mediated unfolded prot
ein response
 IDA biological process
GO:0005615 extracellular space
 IDA cellular component
GO:0010811 positive regulation of ce
ll-substrate adhesion
 IMP biological process
GO:0005154 epidermal growth factor r
eceptor binding
 IPI molecular function
GO:1903078 positive regulation of pr
otein localization to pla
sma membrane
 IMP biological process
GO:0045742 positive regulation of ep
idermal growth factor rec
eptor signaling pathway
 IMP biological process
GO:0034976 response to endoplasmic r
eticulum stress
 IMP NOT|biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0048639 positive regulation of de
velopmental growth
 ISS biological process
GO:0048546 digestive tract morphogen
esis
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0060548 negative regulation of ce
ll death
 IMP biological process
GO:0010628 positive regulation of ge
ne expression
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005783 endoplasmic reticulum
 IMP cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Breast cancer PMID:16598187
pancreatic ductal carcinoma PMID:19609859
in situ carcinoma PMID:19714807
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract