• Gene id: 10550

Gene Summary

• Gene Symbol: ARL6IP5   Gene   UCSC   Ensembl
• Aliases: DERP11, GTRAP3-18, HSPC127, JWA, PRAF3, Yip6b, addicsin, hp22, jmx
• Gene name: ADP ribosylation factor like GTPase 6 interacting protein 5
• Alternate names: PRA1 family protein 3, ADP-ribosylation factor GTPase 6 interacting protein 5, ADP-ribosylation factor-like 6 interacting protein 5, ADP-ribosylation factor-like protein 6-interacting protein 5, ADP-ribosylation-like factor 6 interacting protein 5, ARL-6-inter,
• Gene location: 3p14.1 (69084936: 69106091)     Exons: 3     NC_000003.12
• Gene summary(Entrez): Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell me
• OMIM: 605709

Protein Summary

• Protein general information: O75915  
  • Name: PRA1 family protein 3 (ADP ribosylation factor like protein 6 interacting protein 5) (ARL 6 interacting protein 5) (Aip 5) (Cytoskeleton related vitamin A responsive protein) (Dermal papilla derived protein 11) (GTRAP3 18) (Glutamate transporter EAAC1 int
  • Length: 188  
  • Mass: 21615
• Sequence:

  MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVL
  VFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLEN
  KMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

• Structural information:
  • Interpro: IPR004895  
  • STRING: ENSP00000273258
• Other Databases: GeneCards:  ARL6IP5  Malacards:  ARL6IP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051051	negative regulation of transport	IBA	biological process
GO:0051580	regulation of neurotransmitter uptake	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0002037	negative regulation of L-glutamate import across plasma membrane	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015813	L-glutamate transmembrane transport	IEA	biological process
GO:0002037	negative regulation of L-glutamate import across plasma membrane	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0015813	L-glutamate transmembrane transport	ISS	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IMP	biological process
GO:0010917	negative regulation of mitochondrial membrane potential	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray