• Gene id: 10549

Gene Summary

• Gene Symbol: PRDX4   Gene   UCSC   Ensembl
• Aliases: AOE37-2, AOE372, HEL-S-97n, PRX-4
• Gene name: peroxiredoxin 4
• Alternate names: peroxiredoxin-4, antioxidant enzyme AOE372, epididymis secretory sperm binding protein Li 97n, peroxiredoxin IV, prx-IV, thioredoxin peroxidase (antioxidant enzyme), thioredoxin peroxidase AO372, thioredoxin-dependent peroxide reductase A0372,
• Gene location: Xp22.11 (23664259: 23686398)     Exons: 8     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol w
• OMIM: 300927

Protein Summary

• Protein general information: Q13162  
  • Name: Peroxiredoxin 4 (EC 1.11.1.15) (Antioxidant enzyme AOE372) (AOE37 2) (Peroxiredoxin IV) (Prx IV) (Thioredoxin peroxidase AO372) (Thioredoxin dependent peroxide reductase A0372)
  • Length: 271  
  • Mass: 30,540
• Sequence:

  MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLH
  LSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
  DSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSV
  DETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

• Structural information:
  • Protein Domains: Thioredoxin. (79-237)
  • Interpro: IPR000866  IPR024706  IPR019479  IPR036249  IPR013766  
  • Prosite: PS51352
  • PDB: 2PN8 3TJB 3TJF 3TJG 3TJJ 3TJK 3TKP 3TKQ 3TKR 3TKS 4RQX 5HQP
  • PDBsum: 2PN8 3TJB 3TJF 3TJG 3TJJ 3TJK 3TKP 3TKQ 3TKR 3TKS 4RQX 5HQP
  • STRING: ENSP00000368646
• Other Databases: GeneCards:  PRDX4  Malacards:  PRDX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005790	smooth endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007252	I-kappaB phosphorylation	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008379	thioredoxin peroxidase activity	TAS	molecular function
GO:0008584	male gonad development	IEA	biological process
GO:0019471	4-hydroxyproline metabolic process	IEA	biological process
GO:0022417	protein maturation by protein folding	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072593	reactive oxygen species metabolic process	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:2000255	negative regulation of male germ cell proliferation	IEA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005790	smooth endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007252	I-kappaB phosphorylation	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008379	thioredoxin peroxidase activity	TAS	molecular function
GO:0008584	male gonad development	IEA	biological process
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0019471	4-hydroxyproline metabolic process	IEA	biological process
GO:0022417	protein maturation by protein folding	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072593	reactive oxygen species metabolic process	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:2000255	negative regulation of male germ cell proliferation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0007252	I-kappaB phosphorylation	TAS	biological process
GO:0008379	thioredoxin peroxidase activity	TAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Cancer (lung)	GAD: 20157331
Polycystic ovary syndrome (PCOS)	INFBASE: 24098506
Male factor infertility	MIK: 18068167
Azoospermia	MIK: 18068167
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 18068167
Azoospermia, Male infertility	MIK: 18068167
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18068167	Azoospermia, Male infertility			6 (3 fertile men with normal spermatogenesis, 3 azoospermic patients)	Male infertility	phospholipid hydroperoxide glutathione peroxidase peroxiredoxin 4 (Prx4) heat shock protein beta-1 (HSP27) and cathepsin D (CTSD)
18068167	Azoospermia			6 (3 fertile men with normal spermatogenesis, 3 azoospermic patients )	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881