• Gene id: 10544

Gene Summary

• Gene Symbol: PROCR   Gene   UCSC   Ensembl
• Aliases: CCCA, CCD41, EPCR
• Gene name: protein C receptor
• Alternate names: endothelial protein C receptor, APC receptor, CD201 antigen, activated protein C receptor, cell cycle, centrosome-associated protein, centrocyclin, protein C receptor, endothelial,
• Gene location: 20q11.22 (35172071: 35215988)     Exons: 5     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a receptor for activated protein C, a serine protease activated by and involved in the blood coagulation pathway. The encoded protein is an N-glycosylated type I membrane protein that enhances the activation of protein

Protein Summary

• Protein general information: Q9UNN8  
  • Name: Endothelial protein C receptor (Activated protein C receptor) (APC receptor) (Endothelial cell protein C receptor) (CD antigen CD201)
  • Length: 238  
  • Mass: 26671
  • Tissue specificity: Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney.
• Sequence:

  MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQE
  PESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALW
  QADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGV
  AVGIFLCTGGRRC

• Structural information:
  • Interpro: IPR015669  IPR011161  IPR037055  IPR011162  
  • PDB: 1L8J 1LQV 3JTC 4V3D 4V3E 6SNY
  • PDBsum: 1L8J 1LQV 3JTC 4V3D 4V3E 6SNY
  • DIP: 48671
  • STRING: ENSP00000216968
• Other Databases: GeneCards:  PROCR  Malacards:  PROCR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0050819	negative regulation of coagulation	IBA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0007596	blood coagulation	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0050819	negative regulation of coagulation	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R