• Gene id: 10542

Gene Summary

• Gene Symbol: LAMTOR5   Gene   UCSC   Ensembl
• Aliases: HBXIP, XIP
• Gene name: late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
• Alternate names: ragulator complex protein LAMTOR5, HBV X-interacting protein, HBx-interacting protein, hepatitis B virus x interacting protein, hepatitis B virus x-interacting protein (9.6kD), late endosomal/lysosomal adaptor and MAPK and MTOR activator 5,
• Gene location: 1p13.3 (110407923: 110401252)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by R
• OMIM: 608521

Protein Summary

• Protein general information: O43504  
  • Name: Ragulator complex protein LAMTOR5 (Hepatitis B virus X interacting protein) (HBV X interacting protein) (HBX interacting protein) (Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5)
  • Length: 91  
  • Mass: 9614
  • Tissue specificity: Highly expressed in skeletal and cardiac muscle, followed by pancreas, kidney, liver, brain, placenta and lung. Elevated levels in both cancerous and non-cancerous liver tissue of patients with chronic HBV infection compared with hepat
• Sequence:

  MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIM
  IQKHDGITVAVHKMAS

• Structural information:
  • Interpro: IPR024135  
  • PDB: 3MS6 3MSH 5VOK 5X6U 5X6V 5Y38 5Y39 5Y3A 5YK3 6EHP 6EHR 6NZD 6U62 6ULG
  • PDBsum: 3MS6 3MSH 5VOK 5X6U 5X6V 5Y38 5Y39 5Y3A 5YK3 6EHP 6EHR 6NZD 6U62 6ULG
  • DIP: 61482
  • STRING: ENSP00000256644
• Other Databases: GeneCards:  LAMTOR5  Malacards:  LAMTOR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1905636	positive regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IGI	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IGI	biological process
GO:1904263	positive regulation of TORC1 signaling	IBA	biological process
GO:0071986	Ragulator complex	IBA	cellular component
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IBA	contributes to
GO:0071986	Ragulator complex	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0060090	molecular adaptor activity	IDA	contributes to
GO:0005085	guanyl-nucleotide exchange factor activity	IDA	contributes to
GO:0071230	cellular response to amino acid stimulus	IMP	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0008361	regulation of cell size	IMP	biological process
GO:0061462	protein localization to lysosome	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0071986	Ragulator complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0019079	viral genome replication	IEA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0009615	response to virus	TAS	biological process
GO:0019079	viral genome replication	TAS	biological process
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881