• Gene id: 10541

Gene Summary

• Gene Symbol: ANP32B   Gene   UCSC   Ensembl
• Aliases: APRIL, PHAPI2, SSP29
• Gene name: acidic nuclear phosphoprotein 32 family member B
• Alternate names: acidic leucine-rich nuclear phosphoprotein 32 family member B, acidic (leucine-rich) nuclear phosphoprotein 32 family, member B, acidic protein rich in leucines, putative HLA-DR-associated protein I-2, silver-stainable protein SSP29,
• Gene location: 9q22.33 (97983340: 98015942)     Exons: 7     NC_000009.12

Protein Summary

• Protein general information: Q92688  
  • Name: Acidic leucine rich nuclear phosphoprotein 32 family member B (Acidic protein rich in leucines) (Putative HLA DR associated protein I 2) (PHAPI2) (Silver stainable protein SSP29)
  • Length: 251  
  • Mass: 28788
  • Tissue specificity: Expressed in heart, lung, pancreas, prostate and in spleen, thymus and placenta. {ECO
• Sequence:

  MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENR
  IFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDR
  EDQEAPDSDAEVDGVDEEEEDEEGEDEEDEDDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDE
  DEDEEEEEGGKGEKRKRETDDEGEDD

• Structural information:
  • Protein Domains: (123..16-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR032675  IPR003603  
  • Prosite: PS51450
  • PDB: 2ELL 2RR6
  • PDBsum: 2ELL 2RR6
  • STRING: ENSP00000345848
• Other Databases: GeneCards:  ANP32B  Malacards:  ANP32B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001944	vasculature development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0021591	ventricular system development	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070063	RNA polymerase binding	IDA	molecular function
GO:0045596	negative regulation of cell differentiation	IDA	biological process
GO:0042393	histone binding	IDA	molecular function
GO:0006334	nucleosome assembly	IDA	biological process
GO:0005730	nucleolus	IDA	colocalizes with
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046827	positive regulation of protein export from nucleus	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)