• Gene id: 1054

Gene Summary

• Gene Symbol: CEBPG   Gene   UCSC   Ensembl
• Aliases: GPE1BP, IG/EBP-1
• Gene name: CCAAT enhancer binding protein gamma
• Alternate names: CCAAT/enhancer-binding protein gamma, CCAAT/enhancer binding protein (C/EBP), gamma, c/EBP gamma,
• Gene location: 19q13.11 (10940152: 10931942)     Exons: 4     NC_000007.14
• Gene summary(Entrez): The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involv
• OMIM: 138972

SNPs

rs1042838

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.101062681C>A
NC_000011.10   g.101062681C>G
NC_000011.9   g.100933412C>A
NC_000011.9   g.100933412C>G
NG_016475.1   g.72133G>T
NG_016475.1   g.72133G>C
NM_000926.4   c.1978G>T
NM_000926.4   c.1978G>C
NM_001202474.3   c.1486G>T
NM_001202474.3   c.1486G>C
  

Protein Summary

• Protein general information: P53567  
  • Name: CCAAT/enhancer binding protein gamma (C/EBP gamma)
  • Length: 150  
  • Mass: 16408
• Sequence:

  MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMA
  VKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

• Structural information:
  • Protein Domains: (62..12-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR004827  
  • Prosite: PS50217
  • STRING: ENSP00000284000
• Other Databases: GeneCards:  CEBPG  Malacards:  CEBPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0042267	natural killer cell mediated cytotoxicity	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0016071	mRNA metabolic process	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0044377	RNA polymerase II cis-regulatory region sequence-specific DNA binding, bending	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0043353	enucleate erythrocyte differentiation	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0001889	liver development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008134	transcription factor binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0045078	positive regulation of interferon-gamma biosynthetic process	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0043388	positive regulation of DNA binding	TAS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0006955	immune response	ISS	biological process
GO:0001889	liver development	ISS	biological process
GO:0042267	natural killer cell mediated cytotoxicity	ISS	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0045739	positive regulation of DNA repair	IEP	biological process
GO:0043353	enucleate erythrocyte differentiation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray