• Gene id: 10538

Gene Summary

• Gene Symbol: BATF   Gene   UCSC   Ensembl
• Aliases: B-ATF, BATF1, SFA-2, SFA2
• Gene name: basic leucine zipper ATF-like transcription factor
• Alternate names: basic leucine zipper transcriptional factor ATF-like, B-cell-activating transcription factor, SF-HT-activated gene 2 protein, activating transcription factor B, basic leucine zipper transcription factor, ATF-like,
• Gene location: 14q24.3 (1413287: 1543672)     Exons: 19     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein
• OMIM: 612476

Protein Summary

• Protein general information: Q16520  
  • Name: Basic leucine zipper transcriptional factor ATF like (B cell activating transcription factor) (B ATF) (SF HT activated gene 2 protein) (SFA 2)
  • Length: 125  
  • Mass: 14120
  • Tissue specificity: Expressed at highest levels in lung, and at lower levels in placenta, liver, kidney, spleen, and peripheral blood. Detected in SW480 colorectal cancer cell line and several hematopoietic tumor cell lines, including Raji Burkitt's lymph
• Sequence:

  MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQL
  TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP

• Structural information:
  • Protein Domains: (26..8-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR000837  IPR029820  IPR004827  
  • Prosite: PS50217 PS00036
  • DIP: 52482
  • STRING: ENSP00000286639
• Other Databases: GeneCards:  BATF  Malacards:  BATF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0043565	sequence-specific DNA binding	ISS	molecular function
GO:0042832	defense response to protozoan	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0072540	T-helper 17 cell lineage commitment	ISS	biological process
GO:0072539	T-helper 17 cell differentiation	ISS	biological process
GO:0060218	hematopoietic stem cell differentiation	ISS	biological process
GO:0045190	isotype switching	ISS	biological process
GO:0045064	T-helper 2 cell differentiation	ISS	biological process
GO:0043011	myeloid dendritic cell differentiation	ISS	biological process
GO:0030330	DNA damage response, signal transduction by p53 class mediator	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0002320	lymphoid progenitor cell differentiation	ISS	biological process
GO:0001816	cytokine production	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042832	defense response to protozoan	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0001816	cytokine production	IEA	biological process
GO:0002320	lymphoid progenitor cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IEA	biological process
GO:0043011	myeloid dendritic cell differentiation	IEA	biological process
GO:0045064	T-helper 2 cell differentiation	IEA	biological process
GO:0045190	isotype switching	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060218	hematopoietic stem cell differentiation	IEA	biological process
GO:0072539	T-helper 17 cell differentiation	IEA	biological process
GO:0072540	T-helper 17 cell lineage commitment	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881