• Gene id: 10535

Gene Summary

• Gene Symbol: RNASEH2A   Gene   UCSC   Ensembl
• Aliases: AGS4, JUNB, RNASEHI, RNHIA, RNHL, THSD8
• Gene name: ribonuclease H2 subunit A
• Alternate names: ribonuclease H2 subunit A, RNase H(35), RNase H2 subunit A, RNase HI large subunit, aicardi-Goutieres syndrome 4 protein, ribonuclease H2, large subunit, ribonuclease HI large subunit, ribonuclease HI subunit A,
• Gene location: 19p13.13 (12802053: 12813644)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a component of the heterotrimeric type II ribonuclease H enzyme (RNAseH2). RNAseH2 is the major source of ribonuclease H activity in mammalian cells and endonucleolytically cleaves ribonucleotides. It is predicted to re

Protein Summary

• Protein general information: O75792  
  • Name: Ribonuclease H2 subunit A (RNase H2 subunit A) (EC 3.1.26.4) (Aicardi Goutieres syndrome 4 protein) (AGS4) (RNase H(35)) (Ribonuclease HI large subunit) (RNase HI large subunit) (Ribonuclease HI subunit A)
  • Length: 299  
  • Mass: 33395
• Sequence:

  MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESE
  RERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDTATGLIQYALDQGVNVTQVFVDTVGMPETYQ
  ARLQQSFPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVE
  PVFGFPQFVRFSWRTAQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESATSL

• Structural information:
  • Interpro: IPR004649  IPR001352  IPR024567  IPR023160  IPR012337   IPR036397  
  • PDB: 3P56 3PUF
  • PDBsum: 3P56 3PUF
  • STRING: ENSP00000221486
• Other Databases: GeneCards:  RNASEH2A  Malacards:  RNASEH2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043137	DNA replication, removal of RNA primer	IBA	biological process
GO:0006298	mismatch repair	IBA	biological process
GO:0032299	ribonuclease H2 complex	IBA	cellular component
GO:0004523	RNA-DNA hybrid ribonuclease activity	IBA	molecular function
GO:0006401	RNA catabolic process	IDA	biological process
GO:0032299	ribonuclease H2 complex	IDA	cellular component
GO:0004523	RNA-DNA hybrid ribonuclease activity	IDA	molecular function
GO:0006260	DNA replication	TAS	biological process
GO:0016070	RNA metabolic process	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0004523	RNA-DNA hybrid ribonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0006260	DNA replication	TAS	biological process
GO:0006401	RNA catabolic process	TAS	biological process
GO:0004523	RNA-DNA hybrid ribonuclease activity	IEA	molecular function
GO:0006298	mismatch repair	IDA	biological process
GO:0006298	mismatch repair	IEA	biological process
GO:0032299	ribonuclease H2 complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03030	DNA replication

Diseases

Associated diseases	References
Aicardi-Goutieres syndrome	KEGG:H00290
Aicardi-Goutieres syndrome	KEGG:H00290
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881