• Gene id: 10525

Gene Summary

• Gene Symbol: HYOU1   Gene   UCSC   Ensembl
• Aliases: GRP-170, Grp170, HSP12A, IMD59, ORP-150, ORP150
• Gene name: hypoxia up-regulated 1
• Alternate names: hypoxia up-regulated protein 1, 150 kDa oxygen-regulated protein, 170 kDa glucose-regulated protein, epididymis secretory sperm binding protein, oxygen regulated protein (150kD),
• Gene location: 11q23.3 (119057204: 119044186)     Exons: 27     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this p
• OMIM: 617603

Protein Summary

• Protein general information: Q9Y4L1  
  • Name: Hypoxia up regulated protein 1 (150 kDa oxygen regulated protein) (ORP 150) (170 kDa glucose regulated protein) (GRP 170)
  • Length: 999  
  • Mass: 111335
  • Tissue specificity: Highly expressed in tissues that contain well-developed endoplasmic reticulum and synthesize large amounts of secretory proteins. Highly expressed in liver and pancreas and lower expression in brain and kidney. Also expressed in macrop
• Sequence:

  MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLK
  ENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVL
  GMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTA
  QNIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
  ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVPGPVQQALQSAEMSLD
  EIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVVYPILVEFT
  REVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVG
  DSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
  VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDKSEAQKPSEKAEAGPE
  GVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFET
  QDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSAL
  DNLLNHSSMFLKGARLIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
  EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELG
  GPGAEPEQKEQSTGQKRPLKNDEL

• Structural information:
  • Interpro: IPR018181  IPR029048  IPR029047  IPR013126  
  • Prosite: PS00329 PS01036
  • STRING: ENSP00000480150
• Other Databases: GeneCards:  HYOU1  Malacards:  HYOU1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002931	response to ischemia	ISS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	biological process
GO:1903298	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0051087	chaperone binding	ISS	molecular function
GO:0005790	smooth endoplasmic reticulum	ISS	cellular component
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:0034976	response to endoplasmic reticulum stress	IEP	biological process
GO:0071456	cellular response to hypoxia	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:1903298	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IBA	biological process
GO:0034663	endoplasmic reticulum chaperone complex	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0071682	endocytic vesicle lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:1903382	negative regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway	IEA	biological process
GO:0034663	endoplasmic reticulum chaperone complex	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0002931	response to ischemia	ISS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	biological process
GO:1903298	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0051087	chaperone binding	ISS	molecular function
GO:0005790	smooth endoplasmic reticulum	ISS	cellular component
GO:0071456	cellular response to hypoxia	IEP	biological process
GO:0034976	response to endoplasmic reticulum stress	IEP	biological process
GO:0071456	cellular response to hypoxia	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:1903298	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IBA	biological process
GO:0034663	endoplasmic reticulum chaperone complex	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0071682	endocytic vesicle lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:1903382	negative regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway	IEA	biological process
GO:0034663	endoplasmic reticulum chaperone complex	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881