Male Infertility Database

Search Result

Gene id

10524

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

KAT5 Gene UCSC Ensembl

Aliases

ESA1, HTATIP, HTATIP1, PLIP, TIP, TIP60, ZC2HC5, cPLA2

Gene name

lysine acetyltransferase 5

Alternate names

histone acetyltransferase KAT5, 60 kDa Tat-interactive protein, HIV-1 Tat interactive protein, 60kDa, K(lysine) acetyltransferase 5, K-acetyltransferase 5, Tat interacting protein, 60kDa, cPLA(2)-interacting protein, cPLA2 interacting protein, histone acetyltrans,

Gene location

11q13.1 (65712017: 65719603) Exons: 6 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclea

OMIM

601409

Protein Summary

Protein general information

Q92993

Name: Histone acetyltransferase KAT5 (EC 2.3.1.48) (60 kDa Tat interactive protein) (Tip60) (Histone acetyltransferase HTATIP) (HIV 1 Tat interactive protein) (Lysine acetyltransferase 5) (cPLA(2) interacting protein)

Length: 513 Mass: 58582

Sequence

MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEA
KTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRK
VEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDI
VTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPP
YQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSI
KKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW

Structural information

Protein Domains	(227..50-) (/note="MYST-type-HAT) (/evidence="ECO:0000255\|PROSITE-ProRule:PRU01063"-)
Interpro:	IPR016181 IPR016197 IPR000953 IPR037995 IPR002717 IPR025995 IPR036388 IPR040706
Prosite:	PS51726
PDB:	2EKO 2OU2 4QQG
PDBsum:	2EKO 2OU2 4QQG
DIP:	5998
MINT:
STRING:	ENSP00000340330

Other Databases

GeneCards: KAT5 Malacards: KAT5

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of tr anscription by RNA polyme rase II	IBA	biological process
GO:0032777	Piccolo NuA4 histone acet yltransferase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0000123	histone acetyltransferase complex	IBA	cellular component
GO:0045892	negative regulation of tr anscription, DNA-template d	IBA	biological process
GO:0042393	histone binding	IBA	molecular function
GO:0010485	H4 histone acetyltransfer ase activity	IBA	molecular function
GO:0004402	histone acetyltransferase activity	IBA	molecular function
GO:0018394	peptidyl-lysine acetylati on	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0061733	peptide-lysine-N-acetyltr ansferase activity	IDA	molecular function
GO:0010508	positive regulation of au tophagy	IDA	biological process
GO:0010212	response to ionizing radi ation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000812	Swr1 complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiqu itin-dependent protein ca tabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0035267	NuA4 histone acetyltransf erase complex	IEA	cellular component
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0016746	transferase activity, tra nsferring acyl groups	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0000729	DNA double-strand break p rocessing	TAS	biological process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological process
GO:0016407	acetyltransferase activit y	TAS	molecular function
GO:0016407	acetyltransferase activit y	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0018394	peptidyl-lysine acetylati on	IEA	biological process
GO:0006357	regulation of transcripti on by RNA polymerase II	IEA	biological process
GO:0061733	peptide-lysine-N-acetyltr ansferase activity	IEA	molecular function
GO:0045944	positive regulation of tr anscription by RNA polyme rase II	IEA	biological process
GO:0010508	positive regulation of au tophagy	IEA	biological process
GO:0005667	transcription regulator c omplex	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0032703	negative regulation of in terleukin-2 production	IDA	biological process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological process
GO:0000122	negative regulation of tr anscription by RNA polyme rase II	IMP	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043967	histone H4 acetylation	IEA	biological process
GO:0032777	Piccolo NuA4 histone acet yltransferase complex	IDA	cellular component
GO:0016573	histone acetylation	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0035267	NuA4 histone acetyltransf erase complex	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	IDA	biological process
GO:0071392	cellular response to estr adiol stimulus	IDA	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0035267	NuA4 histone acetyltransf erase complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1901985	positive regulation of pr otein acetylation	IDA	biological process
GO:0045944	positive regulation of tr anscription by RNA polyme rase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006302	double-strand break repai r	IMP	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05017	Spinocerebellar ataxia

Diseases

Expand All | Collapse All

Associated diseases	References
Breast cancer	PMID:22199269
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All