• Gene id: 10519

Gene Summary

• Gene Symbol: CIB1   Gene   UCSC   Ensembl
• Aliases: CIB, CIBP, KIP1, PRKDCIP, SIP2-28
• Gene name: calcium and integrin binding 1
• Alternate names: calcium and integrin-binding protein 1, DNA-PK interaction protein, DNA-PKcs-interacting protein, DNA-dependent protein kinase interacting protein, SNK-interacting protein 2-28, calcium and integrin binding 1 (calmyrin), testicular secretory protein Li 9,
• Gene location: 15q26.1 (90265758: 90230244)     Exons: 8     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the EF-hand domain-containing calcium-binding superfamily. The encoded protein interacts with many other proteins, including the platelet integrin alpha-IIb-beta-3, DNA-dependent protein kinase, presenilin-2, focal adhesion k
• OMIM: 602293

Protein Summary

• Protein general information: Q99828  
  • Name: Calcium and integrin binding protein 1 (CIB) (Calcium and integrin binding protein) (CIBP) (Calmyrin) (DNA PKcs interacting protein) (Kinase interacting protein) (KIP) (SNK interacting protein 2 28) (SIP2 28)
  • Length: 191  
  • Mass: 21,703
• Sequence:

  MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICR
  VFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMK
  QLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL

• Structural information:
  • Protein Domains: EF-hand (103-138)
    EF-hand (148-183)
  • Interpro: IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • PDB: 1DGU 1DGV 1XO5 1Y1A 2L4H 2L4I 2LM5
  • PDBsum: 1DGU 1DGV 1XO5 1Y1A 2L4H 2L4I 2LM5
  • DIP: 31260
  • STRING: ENSP00000333873
• Other Databases: GeneCards:  CIB1  Malacards:  CIB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001954	positive regulation of cell-matrix adhesion	ISS	biological process
GO:0002931	response to ischemia	ISS	biological process
GO:0005509	calcium ion binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IMP	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006302	double-strand break repair	TAS	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IDA	biological process
GO:0007113	endomitotic cell cycle	IDA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IMP	biological process
GO:0008427	calcium-dependent protein kinase inhibitor activity	IMP	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0017016	Ras GTPase binding	IPI	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0030027	lamellipodium	IDA	cellular component
GO:0030220	platelet formation	ISS	biological process
GO:0030291	protein serine/threonine kinase inhibitor activity	IDA	molecular function
GO:0030307	positive regulation of cell growth	ISS	biological process
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030426	growth cone	IDA	cellular component
GO:0031122	cytoplasmic microtubule organization	IMP	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032433	filopodium tip	IDA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0033630	positive regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	ISS	biological process
GO:0042127	regulation of cell proliferation	IMP	biological process
GO:0042383	sarcolemma	IDA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0043495	protein anchor	IGI	molecular function
GO:0044325	ion channel binding	IEA	molecular function
GO:0045653	negative regulation of megakaryocyte differentiation	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051301	cell division	IEA	biological process
GO:0051302	regulation of cell division	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0071363	cellular response to growth factor stimulus	ISS	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	ISS	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0090004	positive regulation of establishment of protein localization to plasma membrane	IGI	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IDA	biological process
GO:2000256	positive regulation of male germ cell proliferation	ISS	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IEA	biological process
GO:0001954	positive regulation of cell-matrix adhesion	ISS	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0002931	response to ischemia	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005509	calcium ion binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IMP	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006302	double-strand break repair	TAS	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IDA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007113	endomitotic cell cycle	IDA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IMP	biological process
GO:0008427	calcium-dependent protein kinase inhibitor activity	IMP	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0017016	Ras GTPase binding	IPI	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0030220	platelet formation	IEA	biological process
GO:0030220	platelet formation	ISS	biological process
GO:0030291	protein serine/threonine kinase inhibitor activity	IDA	molecular function
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0030307	positive regulation of cell growth	ISS	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030426	growth cone	IDA	cellular component
GO:0031122	cytoplasmic microtubule organization	IMP	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032433	filopodium tip	IEA	cellular component
GO:0032433	filopodium tip	IDA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0033630	positive regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	IEA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	ISS	biological process
GO:0042127	regulation of cell proliferation	IMP	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0042383	sarcolemma	IEA	cellular component
GO:0042383	sarcolemma	IDA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0043495	protein anchor	IEA	molecular function
GO:0043495	protein anchor	IGI	molecular function
GO:0044325	ion channel binding	IEA	molecular function
GO:0045653	negative regulation of megakaryocyte differentiation	IEA	biological process
GO:0045653	negative regulation of megakaryocyte differentiation	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051301	cell division	IEA	biological process
GO:0051302	regulation of cell division	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	IEA	biological process
GO:0051898	negative regulation of protein kinase B signaling	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IEA	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	ISS	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	ISS	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0090004	positive regulation of establishment of protein localization to plasma membrane	IEA	biological process
GO:0090004	positive regulation of establishment of protein localization to plasma membrane	IGI	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IDA	biological process
GO:2000256	positive regulation of male germ cell proliferation	IEA	biological process
GO:2000256	positive regulation of male germ cell proliferation	ISS	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001954	positive regulation of cell-matrix adhesion	ISS	biological process
GO:0002931	response to ischemia	ISS	biological process
GO:0005509	calcium ion binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	IMP	cellular component
GO:0005737	cytoplasm	IMP	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006302	double-strand break repair	TAS	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IDA	biological process
GO:0007113	endomitotic cell cycle	IDA	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0008284	positive regulation of cell proliferation	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IMP	biological process
GO:0008427	calcium-dependent protein kinase inhibitor activity	IMP	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0017016	Ras GTPase binding	IPI	molecular function
GO:0030027	lamellipodium	IDA	cellular component
GO:0030220	platelet formation	ISS	biological process
GO:0030291	protein serine/threonine kinase inhibitor activity	IDA	molecular function
GO:0030307	positive regulation of cell growth	ISS	biological process
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0030426	growth cone	IDA	cellular component
GO:0031122	cytoplasmic microtubule organization	IMP	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032433	filopodium tip	IDA	cellular component
GO:0033630	positive regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	ISS	biological process
GO:0042127	regulation of cell proliferation	IMP	biological process
GO:0042383	sarcolemma	IDA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0043495	protein anchor	IGI	molecular function
GO:0045653	negative regulation of megakaryocyte differentiation	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051302	regulation of cell division	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0071363	cellular response to growth factor stimulus	ISS	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	ISS	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:0090004	positive regulation of establishment of protein localization to plasma membrane	IGI	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IDA	biological process
GO:2000256	positive regulation of male germ cell proliferation	ISS	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 24464679
Oligoasthenozoospermia	MIK: 24464679
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Essential for mouse spermatogenesis	MIK: 16982698
Oligoasthenozoospermia	MIK: 24464679
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24464679	Oligoasthenozoospermia		Chinese	44 (25 infertile men ( oligoasthenozoospermia (n?=?13), asthenozoospermia (n?=?12), 19 fertile men)	Male infertility
16982698	Essential for mouse spermatogenesis				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray