• Gene id: 10512

Gene Summary

• Gene Symbol: SEMA3C   Gene   UCSC   Ensembl
• Aliases: SEMAE, SemE
• Gene name: semaphorin 3C
• Alternate names: semaphorin-3C, sema E, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C, semaphorin E,
• Gene location: 7q21.11 (80922388: 80742535)     Exons: 20     NC_000007.14
• Gene summary(Entrez): This gene encodes a secreted glycoprotein that belongs to the semaphorin class 3 family of neuronal guidance cues. The encoded protein contains an N-terminal sema domain, integrin and immunoglobulin-like domains, and a C-terminal basic domain. Homodimeriz
• OMIM: 607940

Protein Summary

• Protein general information: Q99985  
  • Name: Semaphorin 3C (Semaphorin E) (Sema E)
  • Length: 751  
  • Mass: 85207
  • Tissue specificity: Expressed intensely in the heart, skeletal muscle, colon, small intestine, ovary, testis, and prostate. Faint expression ubiquitously among other organs, including brain.
• Sequence:

  MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGSKDHIL
  SLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSED
  QVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVD
  AHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
  HFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPNHQLISYQGRIPYPRP
  GTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLIVRIGTDYKYTKIAVDRVNAADGRYHVLFLG
  TDRGTVQKVVVLPTNNSVSGELILEELEVFKNHAPITTMKISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCC
  LARDPYCAWDGHSCSRFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
  IKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVVTDKWS
  PWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPE
  S

• Structural information:
  • Protein Domains: (28..51-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (571..65-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR016201  IPR001627  IPR036352  IPR027231  IPR015943  
  • Prosite: PS50835 PS51004
  • STRING: ENSP00000265361
• Other Databases: GeneCards:  SEMA3C  Malacards:  SEMA3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001755	neural crest cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0007411	axon guidance	ISS	biological process
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0042493	response to drug	TAS	biological process
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0003215	cardiac right ventricle morphogenesis	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001755	neural crest cell migration	IEA	biological process
GO:1905312	positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA	biological process
GO:0140074	cardiac endothelial to mesenchymal transition	IEA	biological process
GO:0060666	dichotomous subdivision of terminal units involved in salivary gland branching	IEA	biological process
GO:0060174	limb bud formation	IEA	biological process
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0021915	neural tube development	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0003350	pulmonary myocardium development	IEA	biological process
GO:0003148	outflow tract septum morphogenesis	IEA	biological process
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:1905312	positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Rheumatoid arthritis	PMID:15077297
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881