• Gene id: 10500

Gene Summary

• Gene Symbol: SEMA6C   Gene   UCSC   Ensembl
• Aliases: SEMAY, m-SemaY, m-SemaY2
• Gene name: semaphorin 6C
• Alternate names: semaphorin-6C, sema Y, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6C, semaphorin-Y,
• Gene location: 1q21.3 (151148407: 151131684)     Exons: 22     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the semaphorin family. Semaphorins represent important molecular signals controlling multiple aspects of the cellular response that follows CNS injury, and thus may play an important role in neural regeneration. [provided by
• OMIM: 154580

Protein Summary

• Protein general information: Q9H3T2  
  • Name: Semaphorin 6C (Semaphorin Y) (Sema Y)
  • Length: 930  
  • Mass: 99686
  • Tissue specificity: In adult tissues, expressed only in skeletal muscle. {ECO
• Sequence:

  MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGLEDDAVAAELGLDFQRFLTLNRTLLV
  AARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDECYNYIRVLVPWDSQTLLACGTNSFSPVCRS
  YGITSLQQEGEELSGQARCPFDATQSNVAIFAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPH
  FVQALEHGDHVYFFFREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
  QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRSLDGAWTPVSEDRVPSPRPGSCAG
  VGGAALFSSSRDLPDDVLTFIKAHPLLDPAVPPVTHQPLLTLTSRALLTQVAVDGMAGPHSNITVMFLGSNDGTV
  LKVLTPGGRSGGPEPILLEEIDAYSPARCSGKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSRCARHGAC
  QRSCLASQDPYCGWHSSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYGVRRDLPPASASRS
  VPIPLLLASVAAAFALGASVSGLLVSCACRRAHRRRGKDIETPGLPRPLSLRSLARLHGGGPEPPPPSKDGDAVQ
  TPQLYTTFLPPPEGVPPPELACLPTPESTPELPVKHLRAAGDPWEWNQNRNNAKEGPGRSRGGHAAGGPAPRVLV
  RPPPPGCPGQAVEVTTLEELLRYLHGPQPPRKGAEPPAPLTSRALPPEPAPALLGGPSPRPHECASPLRLDVPPE
  GRCASAPARPALSAPAPRLGVGGGRRLPFSGHRAPPALLTRVPSGGPSRYSGGPGKHLLYLGRPEGYRGRALKRV
  DVEKPQLSLKPPLVGPSSRQAVPNGGRFNF

• Structural information:
  • Protein Domains: (30..51-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352"-)
  • Interpro: IPR001627  IPR036352  IPR027231  IPR015514  IPR015943  
  • Prosite: PS51004
  • STRING: ENSP00000357909
• Other Databases: GeneCards:  SEMA6C  Malacards:  SEMA6C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001755	neural crest cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq