• Gene id: 10499

Gene Summary

• Gene Symbol: NCOA2   Gene   UCSC   Ensembl
• Aliases: GRIP1, KAT13C, NCoA-2, SRC2, TIF2, bHLHe75
• Gene name: nuclear receptor coactivator 2
• Alternate names: nuclear receptor coactivator 2, class E basic helix-loop-helix protein 75, glucocorticoid receptor-interacting protein-1, p160 steroid receptor coactivator 2, transcriptional intermediary factor 2,
• Gene location: 8q13.3 (70405389: 70109761)     Exons: 32     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene functions as a transcriptional coactivator for nuclear hormone receptors, including steroid, thyroid, retinoid, and vitamin D receptors. The encoded protein acts as an intermediary factor for the ligand-dependent activity
• OMIM: 601993

Protein Summary

• Protein general information: Q15596  
  • Name: Nuclear receptor coactivator 2 (NCoA 2) (Class E basic helix loop helix protein 75) (bHLHe75) (Transcriptional intermediary factor 2) (hTIF2)
  • Length: 1464  
  • Mass: 159,157
• Sequence:

  MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKE
  TVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVSENVTQYLRYN
  QEELMNKSVYSILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYE
  TMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
  RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHR
  EQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLSSNINFPINGPKEQMGMPMGRFGGSGGMNHV
  SGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGN
  SHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
  ESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGS
  GSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKKENALLRYLLD
  KDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDT
  RPGAPAGSVDKQAIINDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
  PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAMNRP
  VQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPPNQTAPWPESILPIDQASFAS
  QNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIM
  LEQKAPVFPQQYASQAQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQ
  QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMRGQGLNMTPS
  MVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMAHTQSPMMQQSQANPAYQAP
  SDINGWAQGNMGGNSMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLS
  SMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC

• Structural information:
  • Protein Domains: bHLH. (26-83)
    PAS. (119-183)
  • Interpro: IPR011598  IPR010011  IPR032565  IPR036638  IPR028822   IPR009110  IPR014920  IPR037077  IPR017426  IPR000014  IPR035965  IPR013767  IPR014935  
  • Prosite: PS50888 PS50112
  • CDD: cd00083 cd00130
  • PDB: 1GWQ 1GWR 1M2Z 1MV9 1MVC 1MZN 1P93 1T63 1T65 1UHL 1YOK 1ZDT 1ZDU 1ZKY 2AO6 2B1V 2B1Z 2B23 2FAI 2G44 2G5O 2LDC 2P15 2P1T 2P1U 2P1V 2Q7J 2Q7L 2YJD 2ZXZ 2ZY0 3A9E 3CLD 3DZU 3DZY 3E00 3E7C 3E94 3ERD 3FUG 3GN8 3K22 3K23 3KWY 3KYT 3L0E 3L0J 3L0L 3O1D 3O1E 3OAP
  • PDBsum: 1GWQ 1GWR 1M2Z 1MV9 1MVC 1MZN 1P93 1T63 1T65 1UHL 1YOK 1ZDT 1ZDU 1ZKY 2AO6 2B1V 2B1Z 2B23 2FAI 2G44 2G5O 2LDC 2P15 2P1T 2P1U 2P1V 2Q7J 2Q7L 2YJD 2ZXZ 2ZY0 3A9E 3CLD 3DZU 3DZY 3E00 3E7C 3E94 3ERD 3FUG 3GN8 3K22 3K23 3KWY 3KYT 3L0E 3L0J 3L0L 3O1D 3O1E 3OAP
  • DIP: 5997
  • STRING: ENSP00000399968
• Other Databases: GeneCards:  NCOA2  Malacards:  NCOA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IEA	molecular function
GO:0001162	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0010906	regulation of glucose metabolic process	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0016922	ligand-dependent nuclear receptor binding	IPI	molecular function
GO:0021549	cerebellum development	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0030375	thyroid hormone receptor coactivator activity	IEA	molecular function
GO:0030522	intracellular receptor signaling pathway	IBA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0033142	progesterone receptor binding	IEA	molecular function
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0044255	cellular lipid metabolic process	TAS	biological process
GO:0045475	locomotor rhythm	IEA	biological process
GO:0045925	positive regulation of female receptivity	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IBA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0046966	thyroid hormone receptor binding	IEA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0070182	DNA polymerase binding	IEA	molecular function
GO:1904017	cellular response to Thyroglobulin triiodothyronine	IEA	biological process
GO:2000273	positive regulation of receptor activity	IEA	biological process
GO:2000324	positive regulation of glucocorticoid receptor signaling pathway	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IEA	molecular function
GO:0001162	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005102	receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008584	male gonad development	IEA	biological process
GO:0010906	regulation of glucose metabolic process	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0016922	ligand-dependent nuclear receptor binding	IEA	molecular function
GO:0016922	ligand-dependent nuclear receptor binding	IPI	molecular function
GO:0021549	cerebellum development	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0030375	thyroid hormone receptor coactivator activity	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030522	intracellular receptor signaling pathway	IBA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0033142	progesterone receptor binding	IEA	molecular function
GO:0035257	nuclear hormone receptor binding	IEA	molecular function
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0035259	glucocorticoid receptor binding	IEA	molecular function
GO:0042974	retinoic acid receptor binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0044255	cellular lipid metabolic process	TAS	biological process
GO:0045475	locomotor rhythm	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045925	positive regulation of female receptivity	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IBA	biological process
GO:0046965	retinoid X receptor binding	IEA	molecular function
GO:0046966	thyroid hormone receptor binding	IEA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0070182	DNA polymerase binding	IEA	molecular function
GO:1904017	cellular response to Thyroglobulin triiodothyronine	IEA	biological process
GO:2000273	positive regulation of receptor activity	IEA	biological process
GO:2000324	positive regulation of glucocorticoid receptor signaling pathway	IEA	biological process
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0016922	ligand-dependent nuclear receptor binding	IPI	molecular function
GO:0030374	ligand-dependent nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0030522	intracellular receptor signaling pathway	IBA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0044255	cellular lipid metabolic process	TAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 19255064
Cancer (breast)	GAD: 19183483
Carotid artery diseases	GAD: 17903303
Bone diseases	GAD: 19453261
Androgen insensitivity syndrome (AIS)	MIK: 23707616
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Androgen insensitivity syndrome	MIK: 23707616
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23707616	Androgen insensitivity syndrome, AIS				Male infertility	SRC-2 HBO1
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq