• Gene id: 10498

Gene Summary

• Gene Symbol: CARM1   Gene   UCSC   Ensembl
• Aliases: PRMT4
• Gene name: coactivator associated arginine methyltransferase 1
• Alternate names: histone-arginine methyltransferase CARM1, protein arginine N-methyltransferase 4,
• Gene location: 19p13.2 (10871552: 10923077)     Exons: 18     NC_000019.10
• Gene summary(Entrez): This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated protein
• OMIM: 603934

Protein Summary

• Protein general information: Q86X55  
  • Name: Histone arginine methyltransferase CARM1 (EC 2.1.1.319) (Coactivator associated arginine methyltransferase 1) (Protein arginine N methyltransferase 4)
  • Length: 608  
  • Mass: 65854
  • Tissue specificity: Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia. {ECO
• Sequence:

  MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEVRAGPDSAGIALYSHE
  DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYF
  QFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVL
  VKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
  QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFK
  FHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI
  SIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIA
  SGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
  TNTMHYGS

• Structural information:
  • Protein Domains: (146..45-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
  • Interpro: IPR025799  IPR020989  IPR011993  IPR029063  
  • Prosite: PS51678
  • PDB: 2Y1W 2Y1X 4IKP 5DWQ 5DX0 5DX1 5DX8 5DXA 5DXJ 5U4X 6ARJ 6ARV 6D2L 6DVR 6IZQ
  • PDBsum: 2Y1W 2Y1X 4IKP 5DWQ 5DX0 5DX1 5DX8 5DXA 5DXJ 5U4X 6ARJ 6ARV 6D2L 6DVR 6IZQ
  • DIP: 44071
  • STRING: ENSP00000325690
• Other Databases: GeneCards:  CARM1  Malacards:  CARM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008469	histone-arginine N-methyltransferase activity	IDA	molecular function
GO:0070577	lysine-acetylated histone binding	ISS	molecular function
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0033146	regulation of intracellular estrogen receptor signaling pathway	ISS	biological process
GO:0016274	protein-arginine N-methyltransferase activity	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0035642	histone methyltransferase activity (H3-R17 specific)	ISS	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	ISS	molecular function
GO:0034971	histone H3-R17 methylation	ISS	biological process
GO:0034970	histone H3-R2 methylation	IMP	biological process
GO:0030374	nuclear receptor transcription coactivator activity	ISS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0018216	peptidyl-arginine methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IEA	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	IDA	molecular function
GO:0008013	beta-catenin binding	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0016274	protein-arginine N-methyltransferase activity	TAS	molecular function
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0070577	lysine-acetylated histone binding	IEA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0033146	regulation of intracellular estrogen receptor signaling pathway	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0030518	intracellular steroid hormone receptor signaling pathway	IEA	biological process
GO:0016571	histone methylation	IEA	biological process
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008276	protein methyltransferase activity	IEA	molecular function
GO:0006479	protein methylation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0003420	regulation of growth plate cartilage chondrocyte proliferation	IEA	biological process
GO:2000171	negative regulation of dendrite development	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0071168	protein localization to chromatin	IEA	biological process
GO:0060350	endochondral bone morphogenesis	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042054	histone methyltransferase activity	IEA	molecular function
GO:0035642	histone methyltransferase activity (H3-R17 specific)	IEA	molecular function
GO:0035242	protein-arginine omega-N asymmetric methyltransferase activity	IEA	molecular function
GO:0034971	histone H3-R17 methylation	IEA	biological process
GO:0034969	histone arginine methylation	IEA	biological process
GO:0030520	intracellular estrogen receptor signaling pathway	IEA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:1902415	regulation of mRNA binding	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IEA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IEA	biological process
GO:0019919	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0042054	histone methyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016571	histone methylation	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0016571	histone methylation	ISS	biological process
GO:0008276	protein methyltransferase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Estrogen-receptor positive breast cancer	PMID:23887673
prostate carcinoma in situ	PMID:15221992
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R