• Gene id: 10494

Gene Summary

• Gene Symbol: STK25   Gene   UCSC   Ensembl
• Aliases: SOK1, YSK1
• Gene name: serine/threonine kinase 25
• Alternate names: serine/threonine-protein kinase 25, Ste20, yeast homolog, ste20-like kinase, ste20/oxidant stress response kinase 1, sterile 20/oxidant stress-response kinase 1,
• Gene location: 2q37.3 (14689786: 14733741)     Exons: 19     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the germinal centre kinase III (GCK III) subfamily of the sterile 20 superfamily of kinases. The encoded enzyme plays a role in serine-threonine liver kinase B1 (LKB1) signaling pathway to regulate neuronal polarization and m
• OMIM: 602255

Protein Summary

• Protein general information: O00506  
  • Name: Serine/threonine protein kinase 25 (EC 2.7.11.1) (Ste20 like kinase) (Sterile 20/oxidant stress response kinase 1) (SOK 1) (Ste20/oxidant stress response kinase 1)
  • Length: 426  
  • Mass: 48112
  • Tissue specificity: Ubiquitously expressed. Highest levels are found in testis, large intestine, brain and stomach followed by heart and lung.
• Sequence:

  MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDS
  PYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSE
  QGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLF
  LIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGHGEESS
  SEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQ
  SGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR

• Structural information:
  • Protein Domains: (20..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR035060  
  • Prosite: PS00107 PS50011
  • CDD: cd06642
  • PDB: 2XIK 3W8H 4NZW
  • PDBsum: 2XIK 3W8H 4NZW
  • DIP: 34269
  • STRING: ENSP00000325748
• Other Databases: GeneCards:  STK25  Malacards:  STK25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0051645	Golgi localization	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006979	response to oxidative stress	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0051645	Golgi localization	IEA	biological process
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	colocalizes with
GO:0042542	response to hydrogen peroxide	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0032874	positive regulation of stress-activated MAPK cascade	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090168	Golgi reassembly	IMP	biological process
GO:0051683	establishment of Golgi localization	IMP	biological process
GO:0036481	intrinsic apoptotic signaling pathway in response to hydrogen peroxide	IGI	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq