• Gene id: 10493

Gene Summary

• Gene Symbol: VAT1   Gene   UCSC   Ensembl
• Aliases: VATI
• Gene name: vesicle amine transport 1
• Alternate names: synaptic vesicle membrane protein VAT-1 homolog, membrane protein of cholinergic synaptic vesicles, vesicle amine transport protein 1 homolog (T. californica),
• Gene location: 17q21.31 (43022384: 43014606)     Exons: 6     NC_000017.11
• Gene summary(Entrez): Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved i
• OMIM: 616758

Protein Summary

• Protein general information: Q99536  
  • Name: Synaptic vesicle membrane protein VAT 1 homolog (EC 1. . . )
  • Length: 393  
  • Mass: 41920
  • Tissue specificity: Expressed in brain. Also expressed in glioblastoma cells. {ECO
• Sequence:

  MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYDKVKLQSRPAAPPAPG
  PGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNRSGMWQEEVTVP
  SVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVHMAAGGVGMAAVQLCRTVENVTVFGTASASK
  HEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
  LARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQ
  EKKNVGKVLLVPGPEKEN

• Structural information:
  • Interpro: IPR013154  IPR011032  IPR036291  IPR020843  IPR002364  
  • Prosite: PS01162
  • STRING: ENSP00000347872
• Other Databases: GeneCards:  VAT1  Malacards:  VAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010637	negative regulation of mitochondrial fusion	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881