• Gene id: 10492

Gene Summary

• Gene Symbol: SYNCRIP   Gene   UCSC   Ensembl
• Aliases: GRY-RBP, GRYRBP, HNRNPQ, HNRPQ1, NSAP1, PP68, hnRNP-Q
• Gene name: synaptotagmin binding cytoplasmic RNA interacting protein
• Alternate names: heterogeneous nuclear ribonucleoprotein Q, NS1-associated protein 1, glycine- and tyrosine-rich RNA-binding protein,
• Gene location: 6q14.3 (85643861: 85607783)     Exons: 13     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of
• OMIM: 616686

Protein Summary

• Protein general information: O60506  
  • Name: Heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) (Glycine and tyrosine rich RNA binding protein) (GRY RBP) (NS1 associated protein 1) (Synaptotagmin binding, cytoplasmic RNA interacting protein)
  • Length: 623  
  • Mass: 69603
  • Tissue specificity: Ubiquitously expressed. Detected in heart, brain, pancreas, placenta, spleen, lung, liver, skeletal muscle, kidney, thymus, prostate, uterus, small intestine, colon, peripheral blood and testis. {ECO
• Sequence:

  MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALA
  VLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPD
  SVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNN
  HEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAA
  QARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAF
  IHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG
  RGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQ
  RGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDH
  SGNYGYKSENQEFYQDTFGQQWK

• Structural information:
  • Protein Domains: (162..24-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (243..32-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (338..40-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR041337  IPR006535  IPR034544  IPR034548  IPR012677   IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12483 cd12489
  • PDB: 2DGU 2MXT 2NBB 6KOR
  • PDBsum: 2DGU 2MXT 2NBB 6KOR
  • DIP: 35540
  • STRING: ENSP00000358635
• Other Databases: GeneCards:  SYNCRIP  Malacards:  SYNCRIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0070937	CRD-mediated mRNA stability complex	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0070934	CRD-mediated mRNA stabilization	IBA	biological process
GO:0048027	mRNA 5'-UTR binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0097452	GAIT complex	IDA	cellular component
GO:0097452	GAIT complex	IDA	cellular component
GO:0017148	negative regulation of translation	IMP	biological process
GO:0071204	histone pre-mRNA 3'end processing complex	ISS	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0008380	RNA splicing	TAS	biological process
GO:0006396	RNA processing	TAS	biological process
GO:1990904	ribonucleoprotein complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071204	histone pre-mRNA 3'end processing complex	IEA	cellular component
GO:0008143	poly(A) binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0070937	CRD-mediated mRNA stability complex	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0070934	CRD-mediated mRNA stabilization	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq