• Gene id: 10490

Gene Summary

• Gene Symbol: VTI1B   Gene   UCSC   Ensembl
• Aliases: VTI1, VTI1-LIKE, VTI1L, VTI2, v-SNARE, vti1-rp1
• Gene name: vesicle transport through interaction with t-SNAREs 1B
• Alternate names: vesicle transport through interaction with t-SNAREs homolog 1B, vesicle transport v-SNARE protein Vti1-like 1, vesicle-associated soluble NSF attachment protein receptor,
• Gene location: 14q24.1 (67674631: 67647084)     Exons: 6     NC_000014.9
• OMIM: 603207

Protein Summary

• Protein general information: Q9UEU0  
  • Name: Vesicle transport through interaction with t SNAREs homolog 1B (Vesicle transport v SNARE protein Vti1 like 1) (Vti1 rp1)
  • Length: 232  
  • Mass: 26688
  • Tissue specificity: Expressed in all tissues examined.
• Sequence:

  MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRN
  PMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSH
  RIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLELAILGGLVY
  YKFFRSH

• Structural information:
  • Interpro: IPR010989  IPR000727  IPR038407  IPR007705  
  • PDB: 2V8S
  • PDBsum: 2V8S
  • STRING: ENSP00000450731
• Other Databases: GeneCards:  VTI1B  Malacards:  VTI1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0006623	protein targeting to vacuole	IBA	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0012507	ER to Golgi transport vesicle membrane	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0031902	late endosome membrane	IBA	cellular component
GO:0048280	vesicle fusion with Golgi apparatus	IBA	biological process
GO:0000149	SNARE binding	IBA	molecular function
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006896	Golgi to vacuole transport	IBA	biological process
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0097352	autophagosome maturation	IMP	NOT|biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006904	vesicle docking involved in exocytosis	TAS	biological process
GO:0016192	vesicle-mediated transport	TAS	biological process
GO:0061025	membrane fusion	TAS	biological process
GO:0000149	SNARE binding	IDA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0019869	chloride channel inhibitor activity	IDA	molecular function
GO:1903076	regulation of protein localization to plasma membrane	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq