• Gene id: 10488

Gene Summary

• Gene Symbol: CREB3   Gene   UCSC   Ensembl
• Aliases: LUMAN, LZIP, sLZIP
• Gene name: cAMP responsive element binding protein 3
• Alternate names: cyclic AMP-responsive element-binding protein 3, basic leucine zipper protein, cyclic AMP response element (CRE)-binding protein/activating transcription factor 1, leucin zipper proitein, small leucine zipper protein, transcription factor LZIP-alpha,
• Gene location: 9p13.3 (35732665: 35736998)     Exons: 9     NC_000009.12
• Gene summary(Entrez): This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also as
• OMIM: 606443

Protein Summary

• Protein general information: O43889  
  • Name: Cyclic AMP responsive element binding protein 3 (CREB 3) (cAMP responsive element binding protein 3) (Leucine zipper protein) (Luman) (Transcription factor LZIP alpha) [Cleaved into: Processed cyclic AMP responsive element binding protein 3 (N terminal Lu
  • Length: 371  
  • Mass: 41379
  • Tissue specificity: Ubiquitously expressed (PubMed
• Sequence:

  MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLV
  HHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQI
  LKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
  SSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
  VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

• Structural information:
  • Protein Domains: (150..21-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR004827  IPR029808  
  • Prosite: PS50217 PS00036
  • DIP: 33935
  • STRING: ENSP00000342136
• Other Databases: GeneCards:  CREB3  Malacards:  CREB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0006990	positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0005634	nucleus	IC	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0035497	cAMP response element binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0030968	endoplasmic reticulum unfolded protein response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05016	Huntington disease
hsa05165	Human papillomavirus infection
hsa04714	Thermogenesis
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa04022	cGMP-PKG signaling pathway
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04152	AMPK signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04922	Glucagon signaling pathway
hsa04916	Melanogenesis
hsa04668	TNF signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04931	Insulin resistance
hsa04911	Insulin secretion
hsa04211	Longevity regulating pathway
hsa04918	Thyroid hormone synthesis
hsa05215	Prostate cancer
hsa05031	Amphetamine addiction
hsa04927	Cortisol synthesis and secretion
hsa05030	Cocaine addiction
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)