• Gene id: 10487

Gene Summary

• Gene Symbol: CAP1   Gene   UCSC   Ensembl
• Aliases: CAP, CAP1-PEN
• Gene name: cyclase associated actin cytoskeleton regulatory protein 1
• Alternate names: adenylyl cyclase-associated protein 1, CAP, adenylate cyclase-associated protein 1, adenylate cyclase associated protein 1, testis secretory sperm-binding protein Li 218p,
• Gene location: 1p34.2 (40040064: 40072648)     Exons: 16     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively splice
• OMIM: 610309

Protein Summary

• Protein general information: Q01518  
  • Name: Adenylyl cyclase associated protein 1 (CAP 1)
  • Length: 475  
  • Mass: 51901
• Sequence:

  MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEM
  VHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQALGWVAMAPKP
  GPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPS
  AGSCPPPPPPCPPPPPVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
  SAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNC
  KKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNE
  FPVPEQFKTLWNGQKLVTTVTEIAG

• Structural information:
  • Protein Domains: (319..45-)
    (/note="C-CAP/cofactor-C-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00659"-)
  • Interpro: IPR001837  IPR013912  IPR013992  IPR017901  IPR016098   IPR028415  IPR036223  IPR028417  IPR018106  IPR036222  IPR006599  
  • Prosite: PS51329 PS01088 PS01089
  • PDB: 1K8F
  • PDBsum: 1K8F
  • DIP: 62063
  • STRING: ENSP00000361883
• Other Databases: GeneCards:  CAP1  Malacards:  CAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0030864	cortical actin cytoskeleton	IEA	cellular component
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0001667	ameboidal-type cell migration	IEA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008154	actin polymerization or depolymerization	IBA	biological process
GO:0003779	actin binding	IBA	molecular function
GO:0000902	cell morphogenesis	IBA	biological process
GO:0045761	regulation of adenylate cyclase activity	IBA	biological process
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0008179	adenylate cyclase binding	IBA	molecular function
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process

Diseases

Associated diseases	References
pancreatic cancer	PMID:19188911
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R