• Gene id: 10486

Gene Summary

• Gene Symbol: CAP2   Gene   UCSC   Ensembl
• Gene name: cyclase associated actin cytoskeleton regulatory protein 2
• Alternate names: adenylyl cyclase-associated protein 2, 2810452G09Rik, CAP 2, CAP, adenylate cyclase-associated protein, 2,
• Gene location: 6p22.3 (17393504: 17557791)     Exons: 13     NC_000006.12
• Gene summary(Entrez): This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein
• OMIM: 618753

Protein Summary

• Protein general information: P40123  
  • Name: Adenylyl cyclase associated protein 2 (CAP 2)
  • Length: 477  
  • Mass: 52824
• Sequence:

  MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGDVETHA
  EMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESIPALGWIAVSP
  KPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVL
  SSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQ
  SPTKSHTPSPTSPKSYPSQKHAPVLELEGKKWRVEYQEDRNDLVISETELKQVAYIFKCEKSTIQIKGKVNSIII
  DNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIPQDGDY
  REFPIPEQFKTAWDGSKLITEPAEIMA

• Structural information:
  • Protein Domains: (317..45-)
    (/note="C-CAP/cofactor-C-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00659"-)
  • Interpro: IPR001837  IPR013912  IPR013992  IPR017901  IPR016098   IPR028418  IPR036223  IPR028417  IPR018106  IPR036222  IPR006599  
  • Prosite: PS51329 PS01088 PS01089
  • STRING: ENSP00000229922
• Other Databases: GeneCards:  CAP2  Malacards:  CAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000902	cell morphogenesis	IBA	biological process
GO:0003779	actin binding	IBA	molecular function
GO:0008154	actin polymerization or depolymerization	IBA	biological process
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0008179	adenylate cyclase binding	IBA	molecular function
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0045761	regulation of adenylate cyclase activity	IBA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq