• Gene id: 10485

Gene Summary

• Gene Symbol: MIR9-1HG   Gene   UCSC   Ensembl
• Aliases: C1orf61, CROC4
• Gene name: MIR9-1 host gene
• Alternate names: protein CROC-4, contingent replication of cDNA 4, transcriptional activator of the c-fos promoter,
• Gene location: 1q22 (156456648: 156404251)     Exons: 19     NC_000001.11
• OMIM: 159980

Protein Summary

• Protein general information: Q13536  
  • Name: Protein CROC 4 (Contingent replication of cDNA 4)
  • Length: 156  
  • Mass: 17231
  • Tissue specificity: Expressed throughout the brain in the thalamus, subthalamic nucleus, corpus callosum, hippocampus, substantia nigra, caudate nucleus, and amygdala. {ECO
• Sequence:

  MFLTEDLITFNLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSSPRPPGSTSHCGISTR
  CTERCLCVLPLRTSQVPDVMAPQHDQEKFHDLAYSCLGKSFSMSNQDLYGYSTSSLALGLAWLSWETKKKNVLHL
  VGLDSL

• Structural information:
  • Interpro: IPR040529  
• Other Databases: GeneCards:  MIR9-1HG  Malacards:  MIR9-1HG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005634	nucleus	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq