• Gene id: 10481

Gene Summary

• Gene Symbol: HOXB13   Gene   UCSC   Ensembl
• Aliases: HPC9, PSGD
• Gene name: homeobox B13
• Alternate names: homeobox protein Hox-B13,
• Gene location: 17q21.32 (48728749: 48724762)     Exons: 2     NC_000017.11
• Gene summary(Entrez): This gene encodes a transcription factor that belongs to the homeobox gene family. Genes of this family are highly conserved among vertebrates and essential for vertebrate embryonic development. This gene has been implicated to play a role in fetal skin d
• OMIM: 609462

Protein Summary

• Protein general information: Q92826  
  • Name: Homeobox protein Hox B13
  • Length: 284  
  • Mass: 30676
• Sequence:

  MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSP
  APVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQ
  TLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSK
  GQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP

• Structural information:
  • Interpro: IPR009057  IPR017970  IPR001356  IPR022067  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • PDB: 2CRA 5EDN 5EEA 5EF6 5EG0 5EGO 5NO6
  • PDBsum: 2CRA 5EDN 5EEA 5EF6 5EG0 5EGO 5NO6
  • STRING: ENSP00000290295
• Other Databases: GeneCards:  HOXB13  Malacards:  HOXB13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0008544	epidermis development	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0002009	morphogenesis of an epithelium	IEA	biological process
GO:0033574	response to testosterone	IEA	biological process
GO:0060743	epithelial cell maturation involved in prostate gland development	IEA	biological process
GO:0030850	prostate gland development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001525	angiogenesis	IEP	biological process

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:19250546
Prostate cancer	PMID:15583692
Endometrial cancer	PMID:15756448
cervical cancer	PMID:16803519
renal cell carcinoma	PMID:16278676
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881