• Gene id: 10480

Gene Summary

• Gene Symbol: EIF3M   Gene   UCSC   Ensembl
• Aliases: B5, GA17, PCID1, TANGO7, hfl-B5
• Gene name: eukaryotic translation initiation factor 3 subunit M
• Alternate names: eukaryotic translation initiation factor 3 subunit M, B5 receptor, PCI domain containing 1 (herpesvirus entry mediator), PCI domain-containing protein 1, dendritic cell protein, fetal lung protein B5, transport and golgi organization 7 homolog,
• Gene location: 11p13 (32583815: 32606263)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has b
• OMIM: 609641

Protein Summary

• Protein general information: Q7L2H7  
  • Name: Eukaryotic translation initiation factor 3 subunit M (eIF3m) (Fetal lung protein B5) (hFL B5) (PCI domain containing protein 1)
  • Length: 374  
  • Mass: 42503
  • Tissue specificity: Broadly expressed. {ECO
• Sequence:

  MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILE
  PDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKW
  ISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLT
  LKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE
  LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

• Structural information:
  • Protein Domains: (180..33-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR016024  IPR027528  IPR040750  IPR000717  IPR036390  
  • Prosite: PS50250
  • PDB: 3J8B 3J8C 6FEC
  • PDBsum: 3J8B 3J8C 6FEC
  • DIP: 31256
  • STRING: ENSP00000436049
• Other Databases: GeneCards:  EIF3M  Malacards:  EIF3M

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002183	cytoplasmic translational initiation	IBA	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IBA	cellular component
GO:0003743	translation initiation factor activity	IC	contributes to
GO:0003743	translation initiation factor activity	IDA	contributes to
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005852	eukaryotic translation initiation factor 3 complex	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006413	translational initiation	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031369	translation initiation factor binding	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0002183	cytoplasmic translational initiation	IEA	biological process
GO:0016282	eukaryotic 43S preinitiation complex	IEA	cellular component
GO:0033290	eukaryotic 48S preinitiation complex	IEA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0001732	formation of cytoplasmic translation initiation complex	IEA	biological process
GO:0071541	eukaryotic translation initiation factor 3 complex, eIF3m	IEA	cellular component
GO:0006413	translational initiation	IC	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0006413	translational initiation	IC	biological process
GO:0005852	eukaryotic translation initiation factor 3 complex	IDA	cellular component
GO:0003743	translation initiation factor activity	IC	contributes to

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)