• Gene id: 10478

Gene Summary

• Gene Symbol: SLC25A17   Gene   UCSC   Ensembl
• Aliases: PMP34
• Gene name: solute carrier family 25 member 17
• Alternate names: peroxisomal membrane protein PMP34, solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17,
• Gene location: 22q13.2 (40819398: 40769629)     Exons: 12     NC_000022.11
• Gene summary(Entrez): This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants. [provided by Ref
• OMIM: 606795

Protein Summary

• Protein general information: O43808  
  • Name: Peroxisomal membrane protein PMP34 (34 kDa peroxisomal membrane protein) (Solute carrier family 25 member 17)
  • Length: 307  
  • Mass: 34567
  • Tissue specificity: Ubiquitous. Expressed in liver. {ECO
• Sequence:

  MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSL
  CCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGII
  DAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQT
  VQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG
  LKRAHQH

• Structural information:
  • Interpro: IPR002067  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000390722
• Other Databases: GeneCards:  SLC25A17  Malacards:  SLC25A17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005347	ATP transmembrane transporter activity	IBA	molecular function
GO:0051724	NAD transmembrane transporter activity	IBA	molecular function
GO:0005779	integral component of peroxisomal membrane	IBA	cellular component
GO:0015217	ADP transmembrane transporter activity	IBA	molecular function
GO:0015228	coenzyme A transmembrane transporter activity	IBA	molecular function
GO:0015230	FAD transmembrane transporter activity	IBA	molecular function
GO:0044610	FMN transmembrane transporter activity	IBA	molecular function
GO:0080122	AMP transmembrane transporter activity	IBA	molecular function
GO:0051724	NAD transmembrane transporter activity	IDA	molecular function
GO:0080122	AMP transmembrane transporter activity	IDA	molecular function
GO:0044610	FMN transmembrane transporter activity	IDA	molecular function
GO:0015230	FAD transmembrane transporter activity	IDA	molecular function
GO:0015228	coenzyme A transmembrane transporter activity	IDA	molecular function
GO:0015217	ADP transmembrane transporter activity	IDA	molecular function
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000295	adenine nucleotide transmembrane transporter activity	TAS	molecular function
GO:0001561	fatty acid alpha-oxidation	TAS	biological process
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005347	ATP transmembrane transporter activity	IGI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0006635	fatty acid beta-oxidation	IGI	biological process
GO:0015867	ATP transport	IGI	biological process
GO:0015908	fatty acid transport	IGI	biological process
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0035352	NAD transmembrane transport	IEA	biological process
GO:0035352	NAD transmembrane transport	IEA	biological process
GO:0035349	coenzyme A transmembrane transport	IEA	biological process
GO:0035349	coenzyme A transmembrane transport	IEA	biological process
GO:1901679	nucleotide transmembrane transport	IEA	biological process
GO:1901679	nucleotide transmembrane transport	IEA	biological process
GO:0080121	AMP transport	IEA	biological process
GO:0080121	AMP transport	IEA	biological process
GO:0035350	FAD transmembrane transport	IEA	biological process
GO:0035350	FAD transmembrane transport	IEA	biological process
GO:0015866	ADP transport	IEA	biological process
GO:0015866	ADP transport	IEA	biological process
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq