• Gene id: 10477

Gene Summary

• Gene Symbol: UBE2E3   Gene   UCSC   Ensembl
• Aliases: UBCH9, UbcM2
• Gene name: ubiquitin conjugating enzyme E2 E3
• Alternate names: ubiquitin-conjugating enzyme E2 E3, E2 ubiquitin-conjugating enzyme E3, ubiquitin carrier protein E3, ubiquitin conjugating enzyme E2E 3, ubiquitin-conjugating enzyme E2-23 kDa, ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast), ubiquitin-conjugating e,
• Gene location: 2q31.3 (149329984: 149474147)     Exons: 9     NC_000002.12
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju
• OMIM: 604151

Protein Summary

• Protein general information: Q969T4  
  • Name: Ubiquitin conjugating enzyme E2 E3 (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme E3) (UbcH9) (Ubiquitin carrier protein E3) (Ubiquitin conjugating enzyme E2 23 kDa) (Ubiquitin protein ligase E3)
  • Length: 207  
  • Mass: 22913
  • Tissue specificity: Ubiquitously expressed at low levels. Highly expressed in skeletal muscle. {ECO
• Sequence:

  MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITL
  DPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILK
  DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • STRING: ENSP00000386788
• Other Databases: GeneCards:  UBE2E3  Malacards:  UBE2E3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070979	protein K11-linked ubiquitination	IBA	biological process
GO:0070936	protein K48-linked ubiquitination	IBA	biological process
GO:0070534	protein K63-linked ubiquitination	IBA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)