• Gene id: 10476

Gene Summary

• Gene Symbol: ATP5PD   Gene   UCSC   Ensembl
• Aliases: APT5H, ATP5H, ATPQ
• Gene name: ATP synthase peripheral stalk subunit d
• Alternate names: ATP synthase subunit d, mitochondrial, ATP synthase D chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d, ATP synthase, H+ transporting, mitochondrial F1F0, subunit d, ATP synthase, H+ transporting, mitochondrial Fo compl,
• Gene location: 17q25.1 (75046968: 75038862)     Exons: 6     NC_000017.11
• Gene summary(Entrez): Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the
• OMIM: 618121

Protein Summary

• Protein general information: O75947  
  • Name: ATP synthase subunit d, mitochondrial (ATPase subunit d) (ATP synthase peripheral stalk subunit d)
  • Length: 161  
  • Mass: 18491
• Sequence:

  MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFN
  ALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY
  PYWPHQPIENL

• Structural information:
  • Interpro: IPR008689  IPR036228  
  • STRING: ENSP00000301587
• Other Databases: GeneCards:  ATP5PD  Malacards:  ATP5PD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015986	ATP synthesis coupled proton transport	IBA	biological process
GO:0000274	mitochondrial proton-transporting ATP synthase, stator stalk	IBA	cellular component
GO:0015986	ATP synthesis coupled proton transport	IEA	biological process
GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0015078	proton transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0042407	cristae formation	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0042776	mitochondrial ATP synthesis coupled proton transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0042776	mitochondrial ATP synthesis coupled proton transport	IDA	biological process
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	IDA	contributes to
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)