• Gene id: 10474

Gene Summary

• Gene Symbol: TADA3   Gene   UCSC   Ensembl
• Aliases: ADA3, NGG1, STAF54, TADA3L, hADA3
• Gene name: transcriptional adaptor 3
• Alternate names: transcriptional adapter 3, ADA3 homolog, ADA3-like protein, alteration/deficiency in activation 3, epididymis secretory sperm binding protein,
• Gene location: 3p25.3 (9793010: 9779963)     Exons: 9     NC_000003.12
• Gene summary(Entrez): DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosome
• OMIM: 602945

Protein Summary

• Protein general information: O75528  
  • Name: Transcriptional adapter 3 (ADA3 homolog) (hADA3) (STAF54) (Transcriptional adapter 3 like) (ADA3 like protein)
  • Length: 432  
  • Mass: 48902
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQ
  DKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDA
  PNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGL
  MGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPR
  NQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEV
  SRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG

• Structural information:
  • Interpro: IPR019340  
  • STRING: ENSP00000307684
• Other Databases: GeneCards:  TADA3  Malacards:  TADA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000124	SAGA complex	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0043966	histone H3 acetylation	IBA	biological process
GO:0043967	histone H4 acetylation	IBA	biological process
GO:0004402	histone acetyltransferase activity	IBA	contributes to
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0090043	regulation of tubulin deacetylation	IEA	biological process
GO:0072686	mitotic spindle	IEA	cellular component
GO:0031647	regulation of protein stability	IEA	biological process
GO:0031063	regulation of histone deacetylation	IEA	biological process
GO:0030914	STAGA complex	IEA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0030914	STAGA complex	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0030520	intracellular estrogen receptor signaling pathway	TAS	biological process
GO:0016922	nuclear receptor binding	IPI	molecular function
GO:0016922	nuclear receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881