• Gene id: 10473

Gene Summary

• Gene Symbol: HMGN4   Gene   UCSC   Ensembl
• Aliases: HMG17L3, NHC
• Gene name: high mobility group nucleosomal binding domain 4
• Alternate names: high mobility group nucleosome-binding domain-containing protein 4, high mobility group protein N4, high-mobility group (nonhistone chromosomal) protein 17-like 3, high-mobility group protein 17-like 3, non-histone chromosomal protein HMG-17-like 3,
• Gene location: 6p22.2 (96502375: 96567115)     Exons: 23     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. [provided by RefSeq, Mar 2013]

Protein Summary

• Protein general information: O00479  
  • Name: High mobility group nucleosome binding domain containing protein 4 (Non histone chromosomal protein HMG 17 like 3) (Non histone chromosomal protein)
  • Length: 90  
  • Mass: 9539
• Sequence:

  MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDA
  STLQSQKAEGTGDAK

• Structural information:
  • Interpro: IPR000079  
  • Prosite: PS00355
  • STRING: ENSP00000366798
• Other Databases: GeneCards:  HMGN4  Malacards:  HMGN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031492	nucleosomal DNA binding	IEA	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881