• Gene id: 10471

Gene Summary

• Gene Symbol: PFDN6   Gene   UCSC   Ensembl
• Aliases: H2-KE2, HKE2, KE-2, PFD6
• Gene name: prefoldin subunit 6
• Alternate names: prefoldin subunit 6, HLA class II region expressed gene KE2, KE2 protein,
• Gene location: 6p21.32 (33289596: 33290933)     Exons: 5     NC_000006.12
• Gene summary(Entrez): PFDN6 is a subunit of the heteromeric prefoldin complex that chaperones nascent actin (see MIM 102560) and alpha- and beta-tubulin (see MIM 602529 and MIM 191130, respectively) chains pending their transfer to the cytosolic chaperonin containing TCP1 (MIM
• OMIM: 182870

Protein Summary

• Protein general information: O15212  
  • Name: Prefoldin subunit 6 (Protein Ke2)
  • Length: 129  
  • Mass: 14583
• Sequence:

  MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARAT
  VGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA

• Structural information:
  • Interpro: IPR002777  IPR009053  
  • PDB: 6NR8 6NR9 6NRB 6NRC 6NRD
  • PDBsum: 6NR8 6NR9 6NRB 6NRC 6NRD
  • DIP: 50304
  • STRING: ENSP00000378563
• Other Databases: GeneCards:  PFDN6  Malacards:  PFDN6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051131	chaperone-mediated protein complex assembly	IBA	biological process
GO:0006457	protein folding	IBA	biological process
GO:0051087	chaperone binding	IBA	molecular function
GO:0016272	prefoldin complex	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0016272	prefoldin complex	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051087	chaperone binding	IDA	molecular function
GO:0016272	prefoldin complex	IDA	cellular component
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0006457	protein folding	NAS	biological process
GO:0051131	chaperone-mediated protein complex assembly	IBA	biological process
GO:0006457	protein folding	IBA	biological process
GO:0051087	chaperone binding	IBA	molecular function
GO:0016272	prefoldin complex	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0016272	prefoldin complex	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051087	chaperone binding	IDA	molecular function
GO:0016272	prefoldin complex	IDA	cellular component
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0006457	protein folding	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881