• Gene id: 10469

Gene Summary

• Gene Symbol: TIMM44   Gene   UCSC   Ensembl
• Aliases: TIM44
• Gene name: translocase of inner mitochondrial membrane 44
• Alternate names: mitochondrial import inner membrane translocase subunit TIM44, translocase of inner mitochondrial membrane 44 homolog,
• Gene location: 19p13.2 (7943665: 7926717)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene encodes a peripheral membrane protein associated with the mitochondrial inner membrane translocase, which functions in the import of proteins across the mitochondrial inner membrane and into the mitochondrial matrix. The encoded protein mediates
• OMIM: 608379

Protein Summary

• Protein general information: O43615  
  • Name: Mitochondrial import inner membrane translocase subunit TIM44
  • Length: 452  
  • Mass: 51356
• Sequence:

  MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQELAKNK
  EMKESIKKFRDEARRLEESDVLQEARRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVE
  EAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFE
  PNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVL
  TEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNV
  DLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQ
  IL

• Structural information:
  • Interpro: IPR032710  IPR017303  IPR039544  IPR007379  
  • PDB: 2CW9
  • PDBsum: 2CW9
  • STRING: ENSP00000270538
• Other Databases: GeneCards:  TIMM44  Malacards:  TIMM44

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051087	chaperone binding	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0030150	protein import into mitochondrial matrix	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0051087	chaperone binding	IBA	molecular function
GO:0005743	mitochondrial inner membrane	IBA	cellular component
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0030150	protein import into mitochondrial matrix	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006626	protein targeting to mitochondrion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component

Diseases

Associated diseases	References
Diabetic retinopathy	PMID:22003103
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881