• Gene id: 10468

Gene Summary

• Gene Symbol: FST   Gene   UCSC   Ensembl
• Aliases: FS
• Gene name: follistatin
• Alternate names: follistatin, activin-binding protein, follistatin isoform FST317,
• Gene location: 5q11.2 (53480337: 53487133)     Exons: 9     NC_000005.10
• Gene summary(Entrez): Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splici
• OMIM: 136470

Protein Summary

• Protein general information: P19883  
  • Name: Follistatin (FS) (Activin binding protein)
  • Length: 344  
  • Mass: 38,007
• Sequence:

  MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTL
  FKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARC
  KEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATC
  LLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
  ACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

• Structural information:
  • Protein Domains: TB. (30-103)
    Follistatin-like (94-117)
    Kazal-like (112-166)
    Follistatin-like (167-190)
    Kazal-like (186-241)
  • Interpro: IPR003645  IPR015369  IPR002350  IPR036058  IPR017878   IPR036773  
  • Prosite: PS51465 PS51364
  • PDB: 2B0U 2P6A 3HH2 5JHW
  • PDBsum: 2B0U 2P6A 3HH2 5JHW
  • STRING: ENSP00000256759
• Other Databases: GeneCards:  FST  Malacards:  FST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological process
GO:0004871	signal transducer activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0043395	heparan sulfate proteoglycan binding	IEA	molecular function
GO:0048185	activin binding	IPI	molecular function
GO:0051798	positive regulation of hair follicle development	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological process
GO:0004871	signal transducer activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0043395	heparan sulfate proteoglycan binding	IEA	molecular function
GO:0048185	activin binding	IPI	molecular function
GO:0051798	positive regulation of hair follicle development	IDA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological process
GO:0004871	signal transducer activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0048185	activin binding	IPI	molecular function
GO:0051798	positive regulation of hair follicle development	IDA	biological process

Diseases

Associated diseases	References
Cancer (ovarian)	GAD: 20628624
Cleft defects	GAD: 20634891
Obesity	GAD: 20734064
Bone diseases	GAD: 19453261
Implantation failure	INFBASE: 18271891
Female infertility	INFBASE: 19549703
Polycystic ovary syndrome (PCOS)	INFBASE: 23768911
Ovarian endometriosis	INFBASE: 17296189
Disorders of spermatogenesis	MIK: 11275954
Male factor infertility	MIK: 11275954
Deep infiltrating endometriosis	INFBASE: 22416010
Disorders of spermatogenesis	MIK: 11275954
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11275954	Disorders of spermatogenesis			95 (20 proven fertile controls, 15 primary testicular failure, 10 obstructive azoospermia, 10 oligospermia, 40 miscellaneous sperm dysfunction)	Male infertility	Inhibin B activin A follistatin
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)