• Gene id: 10467

Gene Summary

• Gene Symbol: ZNHIT1   Gene   UCSC   Ensembl
• Aliases: CG1I, ZNFN4A1
• Gene name: zinc finger HIT-type containing 1
• Alternate names: zinc finger HIT domain-containing protein 1, H_DJ0747G18.14, cyclin-G1-binding protein 1, p18 Hamlet, p18Hamlet, putative cyclin G1 interacting protein, zinc finger protein subfamily 4A member 1, zinc finger protein, subfamily 4A (HIT domain containing), member ,
• Gene location: 7q22.1 (101218164: 101224190)     Exons: 6     NC_000007.14
• OMIM: 618617

Protein Summary

• Protein general information: O43257  
  • Name: Zinc finger HIT domain containing protein 1 (Cyclin G1 binding protein 1) (Zinc finger protein subfamily 4A member 1) (p18 Hamlet)
  • Length: 154  
  • Mass: 17536
  • Tissue specificity: Expressed abundantly in liver, but weakly in skeletal muscle, ovary and small intestine. {ECO
• Sequence:

  MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDH
  FKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCL
  KWTV

• Structural information:
  • Interpro: IPR039723  IPR007529  
  • Prosite: PS51083
  • STRING: ENSP00000304593
• Other Databases: GeneCards:  ZNHIT1  Malacards:  ZNHIT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000812	Swr1 complex	IBA	cellular component
GO:0031063	regulation of histone deacetylation	IBA	biological process
GO:0031491	nucleosome binding	IBA	molecular function
GO:0042826	histone deacetylase binding	IBA	molecular function
GO:0043486	histone exchange	IBA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006338	chromatin remodeling	IEA	biological process
GO:0043486	histone exchange	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq