• Gene id: 10465

Gene Summary

• Gene Symbol: PPIH   Gene   UCSC   Ensembl
• Aliases: CYP-20, CYPH, SnuCyp-20, USA-CYP
• Gene name: peptidylprolyl isomerase H
• Alternate names: peptidyl-prolyl cis-trans isomerase H, PPIase h, U-snRNP-associated cyclophilin SnuCyp-20, U-snRNP-associated cyclophilin SunCyp-20, USA-CyP SnuCyp-20, cyclophilin H, rotamase H, small nuclear ribonucleoprotein particle-specific cyclophilin H,
• Gene location: 1p34.2 (42657769: 42681653)     Exons: 16     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is
• OMIM: 609682

Protein Summary

• Protein general information: O43447  
  • Name: Peptidyl prolyl cis trans isomerase H (PPIase H) (EC 5.2.1.8) (Rotamase H) (Small nuclear ribonucleoprotein particle specific cyclophilin H) (CypH) (U snRNP associated cyclophilin SnuCyp 20) (USA CYP)
  • Length: 177  
  • Mass: 19208
• Sequence:

  MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQ
  GGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLV
  MRKIENVPTGPNNKPKLPVVISQCGEM

• Structural information:
  • Protein Domains: (14..17-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156"-)
  • Interpro: IPR029000  IPR024936  IPR020892  IPR002130  
  • Prosite: PS00170 PS50072
  • PDB: 1MZW 1QOI 5O9Z 6AHD
  • PDBsum: 1MZW 1QOI 5O9Z 6AHD
  • STRING: ENSP00000306614
• Other Databases: GeneCards:  PPIH  Malacards:  PPIH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0016018	cyclosporin A binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IDA	biological process
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0016018	cyclosporin A binding	TAS	molecular function
GO:0006457	protein folding	TAS	biological process
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0043021	ribonucleoprotein complex binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0005681	spliceosomal complex	IC	cellular component
GO:0071001	U4/U6 snRNP	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881