• Gene id: 10461

Gene Summary

• Gene Symbol: MERTK   Gene   UCSC   Ensembl
• Aliases: MER, RP38, Tyro12, c-Eyk, c-mer
• Gene name: MER proto-oncogene, tyrosine kinase
• Alternate names: tyrosine-protein kinase Mer, MER receptor tyrosine kinase, STK kinase, c-mer proto-oncogene tyrosine kinase, proto-oncogene c-Mer, receptor tyrosine kinase MerTK,
• Gene location: 2q13 (111898606: 112029560)     Exons: 19     NC_000002.12
• Gene summary(Entrez): This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have bee
• OMIM: 618385

Protein Summary

• Protein general information: Q12866  
  • Name: Tyrosine protein kinase Mer (EC 2.7.10.1) (Proto oncogene c Mer) (Receptor tyrosine kinase MerTK)
  • Length: 999  
  • Mass: 110249
  • Tissue specificity: Not expressed in normal B- and T-lymphocytes but is expressed in numerous neoplastic B- and T-cell lines. Highly expressed in testis, ovary, prostate, lung, and kidney, with lower expression in spleen, small intestine, colon, and liver
• Sequence:

  MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHT
  GNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFYPD
  DEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPE
  PVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSI
  LISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWIL
  ASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISV
  QVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISLAI
  RKRVQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGS
  VMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMK
  YGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYS
  GDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDC
  LDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPD
  SIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSML
  PLGSSLPDELLFADDSSEGSEVLM

• Structural information:
  • Protein Domains: (81..18-)
    1 (/note="Ig-like-C2-type)
    (197..27-)
    2 (/note="Ig-like-C2-type)
    (286..38-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (386..48-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO-)
  • Interpro: IPR003961  IPR036116  IPR007110  IPR036179  IPR013783   IPR003599  IPR013151  IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  
  • Prosite: PS50853 PS50835 PS00107 PS50011 PS00109
  • CDD: cd00063
  • PDB: 2DBJ 2P0C 3BPR 3BRB 3TCP 4M3Q 4MH7 4MHA 5K0K 5K0X 5TC0 5TD2 5U6C 6MEP
  • PDBsum: 2DBJ 2P0C 3BPR 3BRB 3TCP 4M3Q 4MH7 4MHA 5K0K 5K0X 5TC0 5TD2 5U6C 6MEP
  • STRING: ENSP00000295408
• Other Databases: GeneCards:  MERTK  Malacards:  MERTK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000107	negative regulation of leukocyte apoptotic process	IMP	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0006909	phagocytosis	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0097350	neutrophil clearance	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0051250	negative regulation of lymphocyte activation	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0001818	negative regulation of cytokine production	IEA	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0060068	vagina development	IEA	biological process
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0032940	secretion by cell	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016028	rhabdomere	IDA	cellular component
GO:0006909	phagocytosis	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0050766	positive regulation of phagocytosis	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Retinitis pigmentosa	KEGG:H00527
Retinitis pigmentosa	KEGG:H00527
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq