• Gene id: 10454

Gene Summary

• Gene Symbol: TAB1   Gene   UCSC   Ensembl
• Aliases: 3'-Tab1, MAP3K7IP1
• Gene name: TGF-beta activated kinase 1 (MAP3K7) binding protein 1
• Alternate names: TGF-beta-activated kinase 1 and MAP3K7-binding protein 1, TAK1-binding protein 1, mitogen-activated protein kinase kinase kinase 7-interacting protein 1, transforming growth factor beta-activated kinase-binding protein 1,
• Gene location: 22q13.1 (39399779: 39437131)     Exons: 12     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein inter
• OMIM: 602615

Protein Summary

• Protein general information: Q15750  
  • Name: TGF beta activated kinase 1 and MAP3K7 binding protein 1 (Mitogen activated protein kinase kinase kinase 7 interacting protein 1) (TGF beta activated kinase 1 binding protein 1) (TAK1 binding protein 1)
  • Length: 504  
  • Mass: 54644
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNR
  VTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQK
  ILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDA
  GKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
  GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQP
  TPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHT
  QSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP

• Structural information:
  • Protein Domains: (28..36-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR036457  IPR001932  
  • Prosite: PS51746
  • CDD: cd00143
  • PDB: 2J4O 2POM 2POP 2YDS 2YIY 4AY5 4AY6 4GS6 4KA3 4L3P 4L52 4L53 4O91 5DIY 5E7R 5GJD 5GJF 5GJG 5J7S 5J8I 5J9L 5JGA 5JGB 5JGD 5JH6 5JK3 5NZZ 5O90 5V5N 5VVU
  • PDBsum: 2J4O 2POM 2POP 2YDS 2YIY 4AY5 4AY6 4GS6 4KA3 4L3P 4L52 4L53 4O91 5DIY 5E7R 5GJD 5GJF 5GJG 5J7S 5J8I 5J9L 5JGA 5JGB 5JGD 5JH6 5JK3 5NZZ 5O90 5V5N 5VVU
  • DIP: 27524
  • STRING: ENSP00000216160
• Other Databases: GeneCards:  TAB1  Malacards:  TAB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0048273	mitogen-activated protein kinase p38 binding	IBA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0000185	activation of MAPKKK activity	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060976	coronary vasculature development	IEA	biological process
GO:0000185	activation of MAPKKK activity	IEA	biological process
GO:0048273	mitogen-activated protein kinase p38 binding	IEA	molecular function
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0035904	aorta development	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0019209	kinase activator activity	IEA	molecular function
GO:0007179	transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0003279	cardiac septum development	IEA	biological process
GO:0003007	heart morphogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05161	Hepatitis B
hsa04380	Osteoclast differentiation
hsa05135	Yersinia infection
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881