• Gene id: 10450

Gene Summary

• Gene Symbol: PPIE   Gene   UCSC   Ensembl
• Aliases: CYP-33, CYP33
• Gene name: peptidylprolyl isomerase E
• Alternate names: peptidyl-prolyl cis-trans isomerase E, PPIase E, cyclophilin-33, peptidylprolyl isomerase E (cyclophilin E), rotamase E,
• Gene location: 1p34.2 (39738844: 39765697)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein con
• OMIM: 601469

Protein Summary

• Protein general information: Q9UNP9  
  • Name: Peptidyl prolyl cis trans isomerase E (PPIase E) (EC 5.2.1.8) (Cyclophilin E) (Cyclophilin 33) (Rotamase E)
  • Length: 301  
  • Mass: 33431
  • Tissue specificity: Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
• Sequence:

  MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGR
  TIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGN
  KPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFI
  LKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEY
  V

• Structural information:
  • Protein Domains: (6..8-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (143..29-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156"-)
  • Interpro: IPR029000  IPR020892  IPR002130  IPR012677  IPR016304   IPR034168  IPR035979  IPR000504  
  • Prosite: PS00170 PS50072 PS50102
  • CDD: cd12347
  • PDB: 1ZMF 2CQB 2KU7 2KYX 2R99 3LPY 3MDF 3UCH 5MQF 5YZG 5Z56 5Z57 6FF7 6ICZ 6ID0 6ID1
  • PDBsum: 1ZMF 2CQB 2KU7 2KYX 2R99 3LPY 3MDF 3UCH 5MQF 5YZG 5Z56 5Z57 6FF7 6ICZ 6ID0 6ID1
  • DIP: 34757
  • STRING: ENSP00000361918
• Other Databases: GeneCards:  PPIE  Malacards:  PPIE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0016018	cyclosporin A binding	IBA	molecular function
GO:0006457	protein folding	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0016018	cyclosporin A binding	IDA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IDA	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008143	poly(A) binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0016018	cyclosporin A binding	TAS	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	TAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881