• Gene id: 1045

Gene Summary

• Gene Symbol: CDX2   Gene   UCSC   Ensembl
• Aliases: CDX-3, CDX2/AS, CDX3
• Gene name: caudal type homeobox 2
• Alternate names: homeobox protein CDX-2, caudal type homeobox transcription factor 2, caudal-type homeobox protein 2, homeobox protein miniCDX2,
• Gene location: 13q12.2 (27969367: 27960917)     Exons: 4     NC_000013.11
• Gene summary(Entrez): This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic devel
• OMIM: 606237

Protein Summary

• Protein general information: Q99626  
  • Name: Homeobox protein CDX 2 (CDX 3) (Caudal type homeobox protein 2)
  • Length: 313  
  • Mass: 33520
• Sequence:

  MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLRE
  DWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAAT
  AAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGL
  SERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVL
  GPTGGVLNPTVTQ

• Structural information:
  • Interpro: IPR006820  IPR009057  IPR017970  IPR001356  IPR020479   IPR000047  
  • Prosite: PS00027 PS50071
  • CDD: cd00086
  • PDB: 5LTY 6ES2 6ES3
  • PDBsum: 5LTY 6ES2 6ES3
  • STRING: ENSP00000370408
• Other Databases: GeneCards:  CDX2  Malacards:  CDX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0009948	anterior/posterior axis specification	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0060575	intestinal epithelial cell differentiation	ISS	biological process
GO:0014807	regulation of somitogenesis	ISS	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:0001824	blastocyst development	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008333	endosome to lysosome transport	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0014807	regulation of somitogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0060575	intestinal epithelial cell differentiation	IEA	biological process
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001568	blood vessel development	IEA	biological process
GO:0001829	trophectodermal cell differentiation	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007389	pattern specification process	IEA	biological process
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0045197	establishment or maintenance of epithelial cell apical/basal polarity	IEA	biological process
GO:0060711	labyrinthine layer development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05226	Gastric cancer

Diseases

Associated diseases	References
Gastric cancer	KEGG:H00018
Gastric cancer	KEGG:H00018
Barrett's esophagus	PMID:23011828
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881