• Gene id: 10446

Gene Summary

• Gene Symbol: LRRN2   Gene   UCSC   Ensembl
• Aliases: FIGLER7, GAC1, LRANK1, LRRN5
• Gene name: leucine rich repeat neuronal 2
• Alternate names: leucine-rich repeat neuronal protein 2, fibronectin type III, immunoglobulin and leucine rich repeat domain 7, glioma amplified on chromosome 1 protein, leucine rich and ankyrin repeats 1, leucine rich repeat neuronal 5, leucine-rich repeat neuronal protein 5,
• Gene location: 1q32.1 (204685835: 204617169)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas. The encoded protein has homology with other proteins that function as cell-adhesion molecules or a
• OMIM: 616082

Protein Summary

• Protein general information: O75325  
  • Name: Leucine rich repeat neuronal protein 2 (Glioma amplified on chromosome 1 protein) (Leucine rich repeat neuronal protein 5)
  • Length: 713  
  • Mass: 78859
  • Tissue specificity: Overamplified in malignant gliomas.
• Sequence:

  MRLLVAPLLLAWVAGATAAVPVVPWHVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFLTAVPPALPAGTQTLL
  LQSNSIVRVDQSELGYLANLTELDLSQNSFSDARDCDFHALPQLLSLHLEENQLTRLEDHSFAGLASLQELYLNH
  NQLYRIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMNL
  REISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
  IDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIRCDC
  VIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVREVPFREMTDHCLPLISPRSFPPSLQVASGESMVLHCRALAE
  PEPEIYWVTPAGLRLTPAHAGRRYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDE
  GQGLELRVQETHPYHILLSWVTPPNTVSTNLTWSSASSLRGQGATALARLPRGTHSYNITRLLQATEYWACLQVA
  FADAHTQLACVWARTKEATSCHRALGDRPGLIAILALAVLLLAAGLAAHLGTGQPRKGVGGRRPLPPAWAFWGWS
  APSVRVVSAPLVLPWNPGRKLPRSSEGETLLPPLSQNS

• Structural information:
  • Protein Domains: (20..6-)
    (/note="LRRNT-)
    (369..42-)
    (/note="LRRCT-)
    (422..51-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000356143
• Other Databases: GeneCards:  LRRN2  Malacards:  LRRN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007155	cell adhesion	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq