• Gene id: 10444

Gene Summary

• Gene Symbol: ZER1   Gene   UCSC   Ensembl
• Aliases: C9orf60, ZYG, ZYG11BL
• Gene name: zyg-11 related cell cycle regulator
• Alternate names: protein zer-1 homolog, ZYG homolog, zer-1 homolog, zyg-11 homolog B-like protein, zyg11b-like protein,
• Gene location: 9q34.11 (28084067: 28021963)     Exons: 20     NC_000008.11
• Gene summary(Entrez): This gene encodes a subunit of an E3 ubiquitin ligase complex that may be involved in meiosis. The encoded protein contains three leucine-rich repeat motifs. [provided by RefSeq, Nov 2012]
• OMIM: 617764

Protein Summary

• Protein general information: Q7Z7L7  
  • Name: Protein zer 1 homolog (Hzyg) (Zyg 11 homolog B like protein) (Zyg11b like protein)
  • Length: 766  
  • Mass: 88169
  • Tissue specificity: Expressed in testis, spermatocytes and spermatids (at protein level). Expressed in spermatocytes, spermatids, prostate, skeletal muscle, ovary, small intestine, heart, brain and pancreas. {ECO
• Sequence:

  MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNAACNFEPHESFFSLFS
  DPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKSLQTLRSFSHTLVSLSLFGCTNIFYEEENPG
  GCEDEYLVNPTCQVLVKDFTFEGFSRLRFLNLGRMIDWVPVESLLRPLNSLAALDLSGIQTSDAAFLTQWKDSLV
  SLVLYNMDLSDDHIRVIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGNLMSLDISGHMILENCSISKM
  EEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGDKNEEQVLNAIEAYTEHRPEITSRAI
  NLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFYLTNSEYRSEQSVKLRRQVIQVVLNGMESYQ
  EVTVQRNCCLTLCNFSIPEELEFQYRRVNELLLSILNPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVV
  TMLKLIQKKLLDKTCDQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVAE
  VKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQREEVEERMWAAIQSWDINSR
  RNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDKYCPLLIKEGGMPLLRDIIKMATARQETKEMARKV
  IEHCSNFKEENMDTSR

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR000225  IPR032675  
  • STRING: ENSP00000291900
• Other Databases: GeneCards:  ZER1  Malacards:  ZER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031462	Cul2-RING ubiquitin ligase complex	IBA	cellular component
GO:0031462	Cul2-RING ubiquitin ligase complex	IDA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0006515	protein quality control for misfolded or incompletely synthesized proteins	IMP	biological process
GO:0031462	Cul2-RING ubiquitin ligase complex	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R